Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7782
Gene name
LocationContig_89:14810..16159
Strand-
Gene length (bp)1349
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.3E-09 59 145
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 5.5E-10 54 129
PF13847 Methyltransf_31 Methyltransferase domain 2.7E-07 55 133
PF08241 Methyltransf_11 Methyltransferase domain 1.8E-06 60 157
PF08003 Methyltransf_9 Protein of unknown function (DUF1698) 4.3E-07 37 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 16 340 3.0E-143
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 3 339 4.0E-143
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 16 323 1.0E-130
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 16 322 2.0E-129
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 16 322 4.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 16 340 3.0E-143
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 3 339 4.0E-143
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 16 323 1.0E-130
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 16 322 2.0E-129
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 16 322 4.0E-129
sp|A2Z0C0|ANM1_ORYSI Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. indica GN=PRMT1 PE=3 SV=1 16 322 4.0E-129
sp|O82210|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2 OS=Arabidopsis thaliana GN=PRMT12 PE=1 SV=1 16 323 1.0E-126
sp|Q54EF2|ANM1_DICDI Protein arginine N-methyltransferase 1 OS=Dictyostelium discoideum GN=prmt1 PE=3 SV=1 6 339 1.0E-124
sp|Q99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens GN=PRMT1 PE=1 SV=2 5 328 2.0E-124
sp|Q63009|ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus GN=Prmt1 PE=1 SV=1 5 328 6.0E-124
sp|Q9JIF0|ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus GN=Prmt1 PE=1 SV=1 5 328 7.0E-124
sp|Q28F07|ANM1_XENTR Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis GN=prmt1 PE=2 SV=1 16 315 3.0E-123
sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 16 315 2.0E-122
sp|Q5RGQ2|ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio GN=prmt8b PE=2 SV=2 16 326 3.0E-122
sp|Q6PAK3|ANM8_MOUSE Protein arginine N-methyltransferase 8 OS=Mus musculus GN=Prmt8 PE=1 SV=2 16 315 6.0E-122
sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 16 315 6.0E-122
sp|Q9NR22|ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens GN=PRMT8 PE=1 SV=2 16 315 7.0E-122
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 20 324 7.0E-103
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 20 324 3.0E-102
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 20 324 1.0E-99
sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 20 320 4.0E-75
sp|Q75G68|ANM62_ORYSJ Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. japonica GN=PRMT6.2 PE=2 SV=1 20 320 5.0E-75
sp|A2Z8S0|ANM62_ORYSI Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. indica GN=PRMT6.2 PE=3 SV=2 20 320 5.0E-75
sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=3 SV=2 12 318 8.0E-73
sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=3 SV=1 12 318 4.0E-72
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 16 322 4.0E-71
sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 14 322 7.0E-67
sp|Q68EZ3|ANM6_XENLA Protein arginine N-methyltransferase 6 OS=Xenopus laevis GN=prmt6 PE=2 SV=1 7 322 2.0E-66
sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 20 320 2.0E-65
sp|Q6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus GN=Prmt6 PE=1 SV=2 17 322 9.0E-65
sp|A3BMN9|ANM3_ORYSJ Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. japonica GN=PRMT3 PE=2 SV=1 1 296 5.0E-64
sp|A2YP56|ANM3_ORYSI Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. indica GN=PRMT3 PE=3 SV=1 1 296 6.0E-64
sp|Q96LA8|ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens GN=PRMT6 PE=1 SV=1 17 322 1.0E-63
sp|Q5E9L5|ANM6_BOVIN Protein arginine N-methyltransferase 6 OS=Bos taurus GN=PRMT6 PE=2 SV=1 17 322 5.0E-60
sp|Q0WVD6|ANM3_ARATH Probable protein arginine N-methyltransferase 3 OS=Arabidopsis thaliana GN=PRMT3 PE=2 SV=1 18 292 4.0E-59
sp|Q54HI0|ANM2_DICDI Protein arginine N-methyltransferase 2 OS=Dictyostelium discoideum GN=prmt2 PE=3 SV=1 15 259 9.0E-56
sp|P55345|ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens GN=PRMT2 PE=1 SV=1 17 334 2.0E-55
sp|B3DLB3|ANM2_XENTR Protein arginine N-methyltransferase 2 OS=Xenopus tropicalis GN=prmt2 PE=2 SV=1 17 320 3.0E-54
sp|Q9R144|ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus GN=Prmt2 PE=1 SV=1 17 292 5.0E-52
sp|D9IVE5|ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis GN=prmt2 PE=1 SV=2 4 320 7.0E-52
sp|Q7XI75|CARM1_ORYSJ Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. japonica GN=CARM1 PE=2 SV=1 16 322 7.0E-50
sp|A2YPT7|CARM1_ORYSI Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. indica GN=CARM1 PE=3 SV=2 16 322 7.0E-50
sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 19 325 3.0E-49
sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=3 SV=1 19 325 3.0E-49
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 OS=Xenopus laevis GN=carm1 PE=2 SV=1 14 316 1.0E-47
sp|A3KPF2|ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana GN=PRMT14 PE=1 SV=1 16 322 1.0E-47
sp|Q84W92|ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana GN=PRMT13 PE=2 SV=3 16 322 2.0E-47
sp|Q86X55|CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens GN=CARM1 PE=1 SV=3 14 316 3.0E-47
sp|Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus GN=Carm1 PE=1 SV=2 14 316 3.0E-47
sp|Q4AE70|CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus GN=Carm1 PE=1 SV=1 14 316 5.0E-47
sp|B0W3L6|CARM1_CULQU Histone-arginine methyltransferase CARMER OS=Culex quinquefasciatus GN=Art4 PE=3 SV=1 16 328 1.0E-46
sp|B4PVH6|CARM1_DROYA Histone-arginine methyltransferase CARMER OS=Drosophila yakuba GN=Art4 PE=3 SV=1 14 318 3.0E-46
sp|Q6DC04|CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio GN=carm1 PE=2 SV=1 14 316 3.0E-46
sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 19 319 4.0E-46
sp|Q29B63|CARM1_DROPS Histone-arginine methyltransferase CARMER OS=Drosophila pseudoobscura pseudoobscura GN=Art4 PE=3 SV=1 14 318 4.0E-46
sp|B4GZ20|CARM1_DROPE Histone-arginine methyltransferase CARMER OS=Drosophila persimilis GN=Art4 PE=3 SV=1 14 318 4.0E-46
sp|B3M1E1|CARM1_DROAN Histone-arginine methyltransferase CARMER OS=Drosophila ananassae GN=Art4 PE=3 SV=1 14 318 4.0E-46
sp|Q9VH48|CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster GN=Art4 PE=1 SV=1 14 318 4.0E-46
sp|B3P4N5|CARM1_DROER Histone-arginine methyltransferase CARMER OS=Drosophila erecta GN=Art4 PE=3 SV=1 14 318 5.0E-46
sp|B4QVW6|CARM1_DROSI Histone-arginine methyltransferase CARMER OS=Drosophila simulans GN=Art4 PE=3 SV=1 14 318 5.0E-46
sp|B4HJC0|CARM1_DROSE Histone-arginine methyltransferase CARMER OS=Drosophila sechellia GN=Art4 PE=3 SV=1 14 318 5.0E-46
sp|B4NKI9|CARM1_DROWI Histone-arginine methyltransferase CARMER OS=Drosophila willistoni GN=Art4 PE=3 SV=1 14 318 6.0E-46
sp|B4KA23|CARM1_DROMO Histone-arginine methyltransferase CARMER OS=Drosophila mojavensis GN=Art4 PE=3 SV=1 14 318 9.0E-46
sp|B4LVS8|CARM1_DROVI Histone-arginine methyltransferase CARMER OS=Drosophila virilis GN=Art4 PE=3 SV=1 14 318 9.0E-46
sp|B4JXV2|CARM1_DROGR Histone-arginine methyltransferase CARMER OS=Drosophila grimshawi GN=Art4 PE=3 SV=1 14 318 1.0E-45
sp|Q7Q2B7|CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae GN=CARM1 PE=1 SV=5 14 330 2.0E-45
sp|Q174R2|CARM1_AEDAE Histone-arginine methyltransferase CARMER OS=Aedes aegypti GN=CARM1 PE=3 SV=1 14 328 3.0E-45
sp|Q582G4|ANM7_TRYB2 Protein arginine N-methyltransferase 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PRMT7 PE=1 SV=1 30 257 2.0E-14
sp|Q6PCI6|ANM7_XENLA Protein arginine N-methyltransferase 7 OS=Xenopus laevis GN=prmt7 PE=2 SV=1 24 300 3.0E-14
sp|A2Y8B9|ANM7_ORYSI Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. indica GN=PRMT7 PE=3 SV=3 32 334 4.0E-14
sp|A2AV36|ANM7_DANRE Protein arginine N-methyltransferase 7 OS=Danio rerio GN=prmt7 PE=2 SV=1 10 298 1.0E-13
sp|Q5VS72|ANM7_ORYSJ Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. japonica GN=PRMT7 PE=2 SV=1 32 334 2.0E-13
sp|Q6P2P2|ANM9_HUMAN Putative protein arginine N-methyltransferase 9 OS=Homo sapiens GN=PRMT9 PE=2 SV=1 33 289 3.0E-13
sp|A0JMU5|ANM9_XENLA Putative protein arginine N-methyltransferase 9 OS=Xenopus laevis GN=prmt9 PE=2 SV=1 30 171 1.0E-11
sp|Q3U3W5|ANM9_MOUSE Putative protein arginine N-methyltransferase 9 OS=Mus musculus GN=Prmt9 PE=2 SV=2 33 176 1.0E-11
sp|C3L3G5|PRMA_CLOB6 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prmA PE=3 SV=1 40 166 2.0E-11
sp|Q5ZIB9|ANM7_CHICK Protein arginine N-methyltransferase 7 OS=Gallus gallus GN=PRMT7 PE=2 SV=1 24 301 3.0E-11
sp|Q9NVM4|ANM7_HUMAN Protein arginine N-methyltransferase 7 OS=Homo sapiens GN=PRMT7 PE=1 SV=1 24 294 4.0E-11
sp|Q5U4E8|ANM7_RAT Protein arginine N-methyltransferase 7 OS=Rattus norvegicus GN=Prmt7 PE=2 SV=1 24 294 4.0E-11
sp|Q16NS8|ANM7_AEDAE Protein arginine N-methyltransferase 7 OS=Aedes aegypti GN=Art7 PE=3 SV=1 32 299 2.0E-10
sp|Q922X9|ANM7_MOUSE Protein arginine N-methyltransferase 7 OS=Mus musculus GN=Prmt7 PE=1 SV=1 24 294 2.0E-10
sp|A6QQV6|ANM7_BOVIN Protein arginine N-methyltransferase 7 OS=Bos taurus GN=PRMT7 PE=2 SV=1 24 294 2.0E-10
sp|Q99MI9|ANM7_CRILO Protein arginine N-methyltransferase 7 OS=Cricetulus longicaudatus GN=Prmt7 PE=1 SV=3 24 294 6.0E-10
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 40 166 8.0E-10
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 40 166 8.0E-10
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 40 166 9.0E-10
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 40 166 9.0E-10
sp|A7FXL3|PRMA_CLOB1 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prmA PE=3 SV=1 40 166 9.0E-10
sp|B1KZN5|PRMA_CLOBM Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prmA PE=3 SV=1 40 166 1.0E-09
sp|B3MF31|ANM7_DROAN Protein arginine N-methyltransferase 7 OS=Drosophila ananassae GN=Art7 PE=3 SV=1 14 292 1.0E-09
sp|B3NP10|ANM7_DROER Protein arginine N-methyltransferase 7 OS=Drosophila erecta GN=Art7 PE=3 SV=1 14 292 2.0E-09
sp|Q9W1V1|ANM7_DROME Protein arginine N-methyltransferase 7 OS=Drosophila melanogaster GN=Art7 PE=2 SV=4 10 292 2.0E-09
sp|B4I8G2|ANM7_DROSE Protein arginine N-methyltransferase 7 OS=Drosophila sechellia GN=Art7 PE=3 SV=1 10 292 2.0E-09
sp|B4QI55|ANM7_DROSI Protein arginine N-methyltransferase 7 OS=Drosophila simulans GN=Art7 PE=3 SV=1 10 292 4.0E-09
sp|B4P925|ANM7_DROYA Protein arginine N-methyltransferase 7 OS=Drosophila yakuba GN=Art7 PE=3 SV=1 10 292 4.0E-09
sp|Q9XW42|ANM7_CAEEL Protein arginine N-methyltransferase 7 OS=Caenorhabditis elegans GN=prmt-7 PE=1 SV=2 47 301 5.0E-09
sp|B4JWL5|ANM7_DROGR Protein arginine N-methyltransferase 7 OS=Drosophila grimshawi GN=Art7 PE=3 SV=1 14 292 1.0E-08
sp|B5DZN7|ANM7_DROPS Protein arginine N-methyltransferase 7 OS=Drosophila pseudoobscura pseudoobscura GN=Art7 PE=3 SV=1 10 300 4.0E-08
sp|A9L3I4|CMOB_SHEB9 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS195) GN=cmoB PE=3 SV=1 27 187 4.0E-08
sp|A6WNQ9|CMOB_SHEB8 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS185) GN=cmoB PE=3 SV=1 27 187 4.0E-08
sp|B8EA68|CMOB_SHEB2 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS223) GN=cmoB PE=3 SV=1 27 187 4.0E-08
sp|Q7QIL2|ANM7_ANOGA Protein arginine N-methyltransferase 7 OS=Anopheles gambiae GN=Art7 PE=3 SV=4 32 171 4.0E-08
sp|A3D474|CMOB_SHEB5 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cmoB PE=3 SV=1 27 187 5.0E-08
sp|A4Y6S2|CMOB_SHEPC tRNA (mo5U34)-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cmoB PE=3 SV=1 27 187 5.0E-08
sp|B3H1F1|CMOB_ACTP7 tRNA (mo5U34)-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cmoB PE=3 SV=1 23 156 1.0E-07
sp|B4GA28|ANM7_DROPE Protein arginine N-methyltransferase 7 OS=Drosophila persimilis GN=Art7 PE=3 SV=1 10 300 2.0E-07
sp|B8I303|PRMA_CLOCE Ribosomal protein L11 methyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prmA PE=3 SV=1 42 183 3.0E-07
sp|B0X4N1|ANM7_CULQU Protein arginine N-methyltransferase 7 OS=Culex quinquefasciatus GN=Art7 PE=3 SV=1 32 171 3.0E-07
sp|B4MNL1|ANM7_DROWI Protein arginine N-methyltransferase 7 OS=Drosophila willistoni GN=Art7 PE=3 SV=1 32 166 5.0E-07
sp|B0BP95|CMOB_ACTPJ tRNA (mo5U34)-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cmoB PE=3 SV=1 23 156 7.0E-07
sp|A3N0H4|CMOB_ACTP2 tRNA (mo5U34)-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cmoB PE=3 SV=1 23 156 7.0E-07
sp|A6LRN8|PRMA_CLOB8 Ribosomal protein L11 methyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=prmA PE=3 SV=1 40 116 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4050
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2817
Ophiocordyceps australis map64 (Brazil) OphauB2|7782 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07361
Ophiocordyceps camponoti-rufipedis Ophun1|6463
Ophiocordyceps kimflemingae Ophio5|7079
Ophiocordyceps subramaniannii Hirsu2|8164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7782
MEVEQAEERMNALEHSEQHYFKSYDHHGIHEEMLKDEVRTRSYMNAIIQNKHLFKDKVVLDVGCGTAILSMFAVR
AGAKHVIGVDMSSIIFKAREIVKVNGMADKITLVQGKMEEVELPFPSVDIIISEWMGYFLLYESMLDTVLYARDK
YLVKGGLIFPDKATIFFAGIEDGDYKEEKIGFWDNVYGFDYTPLKETALSEPLVDNVELKTVVTDPANVLTLDLY
TCTTADLAFTVLFQLTAKRDDFVHALVSWFDIDFTACHKQIRFSTGPHTKYTHWKQTVFYLKEVLTVQQDEEIAC
QLNVRPNSKNRRDLDIELSYRLETSDVTRAAAGECEYHMC*
Coding >OphauB2|7782
ATGGAAGTTGAACAGGCAGAAGAGAGAATGAATGCCCTTGAGCACAGCGAGCAGCATTACTTCAAAAGCTACGAC
CACCATGGTATCCACGAGGAGATGCTGAAAGACGAGGTGCGAACAAGGTCGTACATGAACGCCATTATCCAGAAC
AAGCATCTCTTCAAGGACAAGGTGGTGCTTGATGTCGGCTGCGGGACTGCCATCCTCTCAATGTTCGCCGTCAGG
GCGGGTGCCAAGCACGTCATTGGTGTCGACATGTCATCCATAATTTTCAAGGCAAGGGAAATTGTAAAGGTCAAT
GGCATGGCCGACAAGATTACCTTGGTCCAAGGGAAAATGGAGGAGGTGGAACTGCCTTTTCCAAGCGTGGACATC
ATCATCTCGGAATGGATGGGCTACTTCTTGCTCTACGAATCCATGCTTGATACCGTTCTCTATGCTCGCGACAAG
TACTTGGTCAAGGGTGGGCTGATATTCCCCGACAAGGCCACCATATTCTTTGCAGGTATCGAGGATGGTGACTAT
AAAGAGGAAAAGATTGGTTTCTGGGATAATGTATATGGCTTCGACTACACACCTCTCAAGGAGACTGCTCTTTCG
GAGCCCCTGGTCGACAATGTTGAGCTCAAGACGGTCGTGACCGACCCCGCCAACGTCCTTACCCTCGACCTTTAT
ACTTGCACCACAGCCGACCTGGCTTTTACCGTGCTCTTCCAGCTCACTGCTAAGCGAGACGACTTTGTTCACGCC
CTCGTGTCCTGGTTTGATATTGATTTTACTGCCTGCCACAAGCAAATTCGCTTTTCTACGGGTCCTCATACAAAA
TACACGCACTGGAAACAGACTGTATTTTACCTGAAGGAGGTGCTCACCGTCCAGCAAGACGAGGAGATAGCCTGC
CAGCTCAACGTTCGTCCCAACAGCAAAAACCGGCGCGACCTTGATATTGAACTTTCGTATCGCCTCGAGACAAGC
GACGTTACCCGCGCGGCTGCTGGCGAATGCGAGTACCACATGTGCTAG
Transcript >OphauB2|7782
ATGGAAGTTGAACAGGCAGAAGAGAGAATGAATGCCCTTGAGCACAGCGAGCAGCATTACTTCAAAAGCTACGAC
CACCATGGTATCCACGAGGAGATGCTGAAAGACGAGGTGCGAACAAGGTCGTACATGAACGCCATTATCCAGAAC
AAGCATCTCTTCAAGGACAAGGTGGTGCTTGATGTCGGCTGCGGGACTGCCATCCTCTCAATGTTCGCCGTCAGG
GCGGGTGCCAAGCACGTCATTGGTGTCGACATGTCATCCATAATTTTCAAGGCAAGGGAAATTGTAAAGGTCAAT
GGCATGGCCGACAAGATTACCTTGGTCCAAGGGAAAATGGAGGAGGTGGAACTGCCTTTTCCAAGCGTGGACATC
ATCATCTCGGAATGGATGGGCTACTTCTTGCTCTACGAATCCATGCTTGATACCGTTCTCTATGCTCGCGACAAG
TACTTGGTCAAGGGTGGGCTGATATTCCCCGACAAGGCCACCATATTCTTTGCAGGTATCGAGGATGGTGACTAT
AAAGAGGAAAAGATTGGTTTCTGGGATAATGTATATGGCTTCGACTACACACCTCTCAAGGAGACTGCTCTTTCG
GAGCCCCTGGTCGACAATGTTGAGCTCAAGACGGTCGTGACCGACCCCGCCAACGTCCTTACCCTCGACCTTTAT
ACTTGCACCACAGCCGACCTGGCTTTTACCGTGCTCTTCCAGCTCACTGCTAAGCGAGACGACTTTGTTCACGCC
CTCGTGTCCTGGTTTGATATTGATTTTACTGCCTGCCACAAGCAAATTCGCTTTTCTACGGGTCCTCATACAAAA
TACACGCACTGGAAACAGACTGTATTTTACCTGAAGGAGGTGCTCACCGTCCAGCAAGACGAGGAGATAGCCTGC
CAGCTCAACGTTCGTCCCAACAGCAAAAACCGGCGCGACCTTGATATTGAACTTTCGTATCGCCTCGAGACAAGC
GACGTTACCCGCGCGGCTGCTGGCGAATGCGAGTACCACATGTGCTAG
Gene >OphauB2|7782
ATGGAAGTTGAACAGGCAGAAGAGAGAATGAATGCCCTTGAGCACAGCGAGCAGCATTACTTCAAAAGGTCAGTC
GCCTCTGGGCGCCCACTCGCCTTTTGGGAGTCGCTTGCGAGATCTTGGGCTGATTACGCTCTTATAGCTACGACC
ACCATGGTACCGTTGCCCATTTATCGTCCCTTATTGACTGCTATCATGGCGACTAACCATGGTGCTACACGCGTC
AAGGTATCCACGAGGAGATGCTGGTACGCAACGCCCCATTCGCGGCAGCATCTTTGCGGCAACGCTGACCGCCTT
GACAGAAAGACGAGGTGCGAACAAGGTCGTACATGAACGCCATTATCCAGAACAAGCATCTCTTCAAGGACAAGG
TGGTGCTTGATGTCGGCTGCGGGACTGCCATCCTCTCAATGTAGGTCGTCTGTGTCGTAAACGCTACAAAACTCG
TCCGATTTAACCTCTGTATCGTCAACAGGTTCGCCGTCAGGGCGGGTGCCAAGCACGTCATTGGTGTCGACATGT
CATCCATAATTTTCAAGGCAAGGGAAATTGTAAAGGTCAATGGCATGGCCGACAAGATTACCTTGGTCCAAGGGA
AAATGGAGGAGGTGGAACTGCCTTTTCCAAGCGTGGACATCATCATCTCGGAATGGATGGGCTACTTCTTGCTCT
ACGAATCCATGCTTGATACCGTTCTCTATGCTCGCGACAAGTACTTGGTCAAGGGTGGGCTGATATTCCCCGACA
AGGCCACCATATTCTTTGCAGGTATCGAGGATGGTGACTATAAAGAGGAAAAGATTGGTTGTGAGTGTTTTGCCC
TGGGCCTCGGTCTGACATGTGCTGATGCCACTCTGCTGTCTGTAGTCTGGGATAATGTATATGGCTTCGACTACA
CACCTCTCAAGGAGACTGCTCTTTCGGAGCCCCTGGTCGACAATGTTGAGCTCAAGACGGTCGTGACCGACCCCG
CCAACGTCCTTACCCTCGACCTTTATACTTGCACCACAGCCGACCTGGCTTTTACCGTGCTCTTCCAGCTCACTG
CTAAGCGAGACGACTTTGTTCACGCCCTCGTGTCCTGGTTTGATATTGATTTTACTGCCTGCCACAAGCAAATTC
GCTTTTCTACGGGTCCTCATACAAAATACACGCACTGGAAACAGACTGTATTTTACCTGAAGGAGGTGCTCACCG
TCCAGCAAGACGAGGAGATAGCCTGCCAGCTCAACGTTCGTCCCAACAGCAAAAACCGGCGCGACCTTGATATTG
AACTTTCGTATCGCCTCGAGACAAGCGACGTTACCCGCGCGGCTGCTGGCGAATGCGAGTACCACATGTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail