Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7782
Gene name
LocationContig_89:14810..16159
Strand-
Gene length (bp)1349
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.3E-09 59 145
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 5.5E-10 54 129
PF13847 Methyltransf_31 Methyltransferase domain 2.7E-07 55 133
PF08241 Methyltransf_11 Methyltransferase domain 1.8E-06 60 157
PF08003 Methyltransf_9 Protein of unknown function (DUF1698) 4.3E-07 37 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 16 340 3.0E-143
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 3 339 4.0E-143
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 16 323 1.0E-130
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 16 322 2.0E-129
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 16 322 4.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 16 340 3.0E-143
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 3 339 4.0E-143
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 16 323 1.0E-130
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 16 322 2.0E-129
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 16 322 4.0E-129
sp|A2Z0C0|ANM1_ORYSI Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. indica GN=PRMT1 PE=3 SV=1 16 322 4.0E-129
sp|O82210|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2 OS=Arabidopsis thaliana GN=PRMT12 PE=1 SV=1 16 323 1.0E-126
sp|Q54EF2|ANM1_DICDI Protein arginine N-methyltransferase 1 OS=Dictyostelium discoideum GN=prmt1 PE=3 SV=1 6 339 1.0E-124
sp|Q99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens GN=PRMT1 PE=1 SV=2 5 328 2.0E-124
sp|Q63009|ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus GN=Prmt1 PE=1 SV=1 5 328 6.0E-124
sp|Q9JIF0|ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus GN=Prmt1 PE=1 SV=1 5 328 7.0E-124
sp|Q28F07|ANM1_XENTR Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis GN=prmt1 PE=2 SV=1 16 315 3.0E-123
sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 16 315 2.0E-122
sp|Q5RGQ2|ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio GN=prmt8b PE=2 SV=2 16 326 3.0E-122
sp|Q6PAK3|ANM8_MOUSE Protein arginine N-methyltransferase 8 OS=Mus musculus GN=Prmt8 PE=1 SV=2 16 315 6.0E-122
sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 16 315 6.0E-122
sp|Q9NR22|ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens GN=PRMT8 PE=1 SV=2 16 315 7.0E-122
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 20 324 7.0E-103
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 20 324 3.0E-102
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 20 324 1.0E-99
sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 20 320 4.0E-75
sp|Q75G68|ANM62_ORYSJ Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. japonica GN=PRMT6.2 PE=2 SV=1 20 320 5.0E-75
sp|A2Z8S0|ANM62_ORYSI Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. indica GN=PRMT6.2 PE=3 SV=2 20 320 5.0E-75
sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=3 SV=2 12 318 8.0E-73
sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=3 SV=1 12 318 4.0E-72
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 16 322 4.0E-71
sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 14 322 7.0E-67
sp|Q68EZ3|ANM6_XENLA Protein arginine N-methyltransferase 6 OS=Xenopus laevis GN=prmt6 PE=2 SV=1 7 322 2.0E-66
sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 20 320 2.0E-65
sp|Q6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus GN=Prmt6 PE=1 SV=2 17 322 9.0E-65
sp|A3BMN9|ANM3_ORYSJ Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. japonica GN=PRMT3 PE=2 SV=1 1 296 5.0E-64
sp|A2YP56|ANM3_ORYSI Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. indica GN=PRMT3 PE=3 SV=1 1 296 6.0E-64
sp|Q96LA8|ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens GN=PRMT6 PE=1 SV=1 17 322 1.0E-63
sp|Q5E9L5|ANM6_BOVIN Protein arginine N-methyltransferase 6 OS=Bos taurus GN=PRMT6 PE=2 SV=1 17 322 5.0E-60
sp|Q0WVD6|ANM3_ARATH Probable protein arginine N-methyltransferase 3 OS=Arabidopsis thaliana GN=PRMT3 PE=2 SV=1 18 292 4.0E-59
sp|Q54HI0|ANM2_DICDI Protein arginine N-methyltransferase 2 OS=Dictyostelium discoideum GN=prmt2 PE=3 SV=1 15 259 9.0E-56
sp|P55345|ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens GN=PRMT2 PE=1 SV=1 17 334 2.0E-55
sp|B3DLB3|ANM2_XENTR Protein arginine N-methyltransferase 2 OS=Xenopus tropicalis GN=prmt2 PE=2 SV=1 17 320 3.0E-54
sp|Q9R144|ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus GN=Prmt2 PE=1 SV=1 17 292 5.0E-52
sp|D9IVE5|ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis GN=prmt2 PE=1 SV=2 4 320 7.0E-52
sp|Q7XI75|CARM1_ORYSJ Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. japonica GN=CARM1 PE=2 SV=1 16 322 7.0E-50
sp|A2YPT7|CARM1_ORYSI Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. indica GN=CARM1 PE=3 SV=2 16 322 7.0E-50
sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 19 325 3.0E-49
sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=3 SV=1 19 325 3.0E-49
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 OS=Xenopus laevis GN=carm1 PE=2 SV=1 14 316 1.0E-47
sp|A3KPF2|ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana GN=PRMT14 PE=1 SV=1 16 322 1.0E-47
sp|Q84W92|ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana GN=PRMT13 PE=2 SV=3 16 322 2.0E-47
sp|Q86X55|CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens GN=CARM1 PE=1 SV=3 14 316 3.0E-47
sp|Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus GN=Carm1 PE=1 SV=2 14 316 3.0E-47
sp|Q4AE70|CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus GN=Carm1 PE=1 SV=1 14 316 5.0E-47
sp|B0W3L6|CARM1_CULQU Histone-arginine methyltransferase CARMER OS=Culex quinquefasciatus GN=Art4 PE=3 SV=1 16 328 1.0E-46
sp|B4PVH6|CARM1_DROYA Histone-arginine methyltransferase CARMER OS=Drosophila yakuba GN=Art4 PE=3 SV=1 14 318 3.0E-46
sp|Q6DC04|CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio GN=carm1 PE=2 SV=1 14 316 3.0E-46
sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 19 319 4.0E-46
sp|Q29B63|CARM1_DROPS Histone-arginine methyltransferase CARMER OS=Drosophila pseudoobscura pseudoobscura GN=Art4 PE=3 SV=1 14 318 4.0E-46
sp|B4GZ20|CARM1_DROPE Histone-arginine methyltransferase CARMER OS=Drosophila persimilis GN=Art4 PE=3 SV=1 14 318 4.0E-46
sp|B3M1E1|CARM1_DROAN Histone-arginine methyltransferase CARMER OS=Drosophila ananassae GN=Art4 PE=3 SV=1 14 318 4.0E-46
sp|Q9VH48|CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster GN=Art4 PE=1 SV=1 14 318 4.0E-46
sp|B3P4N5|CARM1_DROER Histone-arginine methyltransferase CARMER OS=Drosophila erecta GN=Art4 PE=3 SV=1 14 318 5.0E-46
sp|B4QVW6|CARM1_DROSI Histone-arginine methyltransferase CARMER OS=Drosophila simulans GN=Art4 PE=3 SV=1 14 318 5.0E-46
sp|B4HJC0|CARM1_DROSE Histone-arginine methyltransferase CARMER OS=Drosophila sechellia GN=Art4 PE=3 SV=1 14 318 5.0E-46
sp|B4NKI9|CARM1_DROWI Histone-arginine methyltransferase CARMER OS=Drosophila willistoni GN=Art4 PE=3 SV=1 14 318 6.0E-46
sp|B4KA23|CARM1_DROMO Histone-arginine methyltransferase CARMER OS=Drosophila mojavensis GN=Art4 PE=3 SV=1 14 318 9.0E-46
sp|B4LVS8|CARM1_DROVI Histone-arginine methyltransferase CARMER OS=Drosophila virilis GN=Art4 PE=3 SV=1 14 318 9.0E-46
sp|B4JXV2|CARM1_DROGR Histone-arginine methyltransferase CARMER OS=Drosophila grimshawi GN=Art4 PE=3 SV=1 14 318 1.0E-45
sp|Q7Q2B7|CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae GN=CARM1 PE=1 SV=5 14 330 2.0E-45
sp|Q174R2|CARM1_AEDAE Histone-arginine methyltransferase CARMER OS=Aedes aegypti GN=CARM1 PE=3 SV=1 14 328 3.0E-45
sp|Q582G4|ANM7_TRYB2 Protein arginine N-methyltransferase 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PRMT7 PE=1 SV=1 30 257 2.0E-14
sp|Q6PCI6|ANM7_XENLA Protein arginine N-methyltransferase 7 OS=Xenopus laevis GN=prmt7 PE=2 SV=1 24 300 3.0E-14
sp|A2Y8B9|ANM7_ORYSI Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. indica GN=PRMT7 PE=3 SV=3 32 334 4.0E-14
sp|A2AV36|ANM7_DANRE Protein arginine N-methyltransferase 7 OS=Danio rerio GN=prmt7 PE=2 SV=1 10 298 1.0E-13
sp|Q5VS72|ANM7_ORYSJ Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. japonica GN=PRMT7 PE=2 SV=1 32 334 2.0E-13
sp|Q6P2P2|ANM9_HUMAN Putative protein arginine N-methyltransferase 9 OS=Homo sapiens GN=PRMT9 PE=2 SV=1 33 289 3.0E-13
sp|A0JMU5|ANM9_XENLA Putative protein arginine N-methyltransferase 9 OS=Xenopus laevis GN=prmt9 PE=2 SV=1 30 171 1.0E-11
sp|Q3U3W5|ANM9_MOUSE Putative protein arginine N-methyltransferase 9 OS=Mus musculus GN=Prmt9 PE=2 SV=2 33 176 1.0E-11
sp|C3L3G5|PRMA_CLOB6 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prmA PE=3 SV=1 40 166 2.0E-11
sp|Q5ZIB9|ANM7_CHICK Protein arginine N-methyltransferase 7 OS=Gallus gallus GN=PRMT7 PE=2 SV=1 24 301 3.0E-11
sp|Q9NVM4|ANM7_HUMAN Protein arginine N-methyltransferase 7 OS=Homo sapiens GN=PRMT7 PE=1 SV=1 24 294 4.0E-11
sp|Q5U4E8|ANM7_RAT Protein arginine N-methyltransferase 7 OS=Rattus norvegicus GN=Prmt7 PE=2 SV=1 24 294 4.0E-11
sp|Q16NS8|ANM7_AEDAE Protein arginine N-methyltransferase 7 OS=Aedes aegypti GN=Art7 PE=3 SV=1 32 299 2.0E-10
sp|Q922X9|ANM7_MOUSE Protein arginine N-methyltransferase 7 OS=Mus musculus GN=Prmt7 PE=1 SV=1 24 294 2.0E-10
sp|A6QQV6|ANM7_BOVIN Protein arginine N-methyltransferase 7 OS=Bos taurus GN=PRMT7 PE=2 SV=1 24 294 2.0E-10
sp|Q99MI9|ANM7_CRILO Protein arginine N-methyltransferase 7 OS=Cricetulus longicaudatus GN=Prmt7 PE=1 SV=3 24 294 6.0E-10
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 40 166 8.0E-10
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 40 166 8.0E-10
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 40 166 9.0E-10
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 40 166 9.0E-10
sp|A7FXL3|PRMA_CLOB1 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prmA PE=3 SV=1 40 166 9.0E-10
sp|B1KZN5|PRMA_CLOBM Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prmA PE=3 SV=1 40 166 1.0E-09
sp|B3MF31|ANM7_DROAN Protein arginine N-methyltransferase 7 OS=Drosophila ananassae GN=Art7 PE=3 SV=1 14 292 1.0E-09
sp|B3NP10|ANM7_DROER Protein arginine N-methyltransferase 7 OS=Drosophila erecta GN=Art7 PE=3 SV=1 14 292 2.0E-09
sp|Q9W1V1|ANM7_DROME Protein arginine N-methyltransferase 7 OS=Drosophila melanogaster GN=Art7 PE=2 SV=4 10 292 2.0E-09
sp|B4I8G2|ANM7_DROSE Protein arginine N-methyltransferase 7 OS=Drosophila sechellia GN=Art7 PE=3 SV=1 10 292 2.0E-09
sp|B4QI55|ANM7_DROSI Protein arginine N-methyltransferase 7 OS=Drosophila simulans GN=Art7 PE=3 SV=1 10 292 4.0E-09
sp|B4P925|ANM7_DROYA Protein arginine N-methyltransferase 7 OS=Drosophila yakuba GN=Art7 PE=3 SV=1 10 292 4.0E-09
sp|Q9XW42|ANM7_CAEEL Protein arginine N-methyltransferase 7 OS=Caenorhabditis elegans GN=prmt-7 PE=1 SV=2 47 301 5.0E-09
sp|B4JWL5|ANM7_DROGR Protein arginine N-methyltransferase 7 OS=Drosophila grimshawi GN=Art7 PE=3 SV=1 14 292 1.0E-08
sp|B5DZN7|ANM7_DROPS Protein arginine N-methyltransferase 7 OS=Drosophila pseudoobscura pseudoobscura GN=Art7 PE=3 SV=1 10 300 4.0E-08
sp|A9L3I4|CMOB_SHEB9 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS195) GN=cmoB PE=3 SV=1 27 187 4.0E-08
sp|A6WNQ9|CMOB_SHEB8 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS185) GN=cmoB PE=3 SV=1 27 187 4.0E-08
sp|B8EA68|CMOB_SHEB2 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS223) GN=cmoB PE=3 SV=1 27 187 4.0E-08
sp|Q7QIL2|ANM7_ANOGA Protein arginine N-methyltransferase 7 OS=Anopheles gambiae GN=Art7 PE=3 SV=4 32 171 4.0E-08
sp|A3D474|CMOB_SHEB5 tRNA (mo5U34)-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cmoB PE=3 SV=1 27 187 5.0E-08
sp|A4Y6S2|CMOB_SHEPC tRNA (mo5U34)-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cmoB PE=3 SV=1 27 187 5.0E-08
sp|B3H1F1|CMOB_ACTP7 tRNA (mo5U34)-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cmoB PE=3 SV=1 23 156 1.0E-07
sp|B4GA28|ANM7_DROPE Protein arginine N-methyltransferase 7 OS=Drosophila persimilis GN=Art7 PE=3 SV=1 10 300 2.0E-07
sp|B8I303|PRMA_CLOCE Ribosomal protein L11 methyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prmA PE=3 SV=1 42 183 3.0E-07
sp|B0X4N1|ANM7_CULQU Protein arginine N-methyltransferase 7 OS=Culex quinquefasciatus GN=Art7 PE=3 SV=1 32 171 3.0E-07
sp|B4MNL1|ANM7_DROWI Protein arginine N-methyltransferase 7 OS=Drosophila willistoni GN=Art7 PE=3 SV=1 32 166 5.0E-07
sp|B0BP95|CMOB_ACTPJ tRNA (mo5U34)-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cmoB PE=3 SV=1 23 156 7.0E-07
sp|A3N0H4|CMOB_ACTP2 tRNA (mo5U34)-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cmoB PE=3 SV=1 23 156 7.0E-07
sp|A6LRN8|PRMA_CLOB8 Ribosomal protein L11 methyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=prmA PE=3 SV=1 40 116 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7782
MEVEQAEERMNALEHSEQHYFKSYDHHGIHEEMLKDEVRTRSYMNAIIQNKHLFKDKVVLDVGCGTAILSMFAVR
AGAKHVIGVDMSSIIFKAREIVKVNGMADKITLVQGKMEEVELPFPSVDIIISEWMGYFLLYESMLDTVLYARDK
YLVKGGLIFPDKATIFFAGIEDGDYKEEKIGFWDNVYGFDYTPLKETALSEPLVDNVELKTVVTDPANVLTLDLY
TCTTADLAFTVLFQLTAKRDDFVHALVSWFDIDFTACHKQIRFSTGPHTKYTHWKQTVFYLKEVLTVQQDEEIAC
QLNVRPNSKNRRDLDIELSYRLETSDVTRAAAGECEYHMC*
Coding >OphauB2|7782
ATGGAAGTTGAACAGGCAGAAGAGAGAATGAATGCCCTTGAGCACAGCGAGCAGCATTACTTCAAAAGCTACGAC
CACCATGGTATCCACGAGGAGATGCTGAAAGACGAGGTGCGAACAAGGTCGTACATGAACGCCATTATCCAGAAC
AAGCATCTCTTCAAGGACAAGGTGGTGCTTGATGTCGGCTGCGGGACTGCCATCCTCTCAATGTTCGCCGTCAGG
GCGGGTGCCAAGCACGTCATTGGTGTCGACATGTCATCCATAATTTTCAAGGCAAGGGAAATTGTAAAGGTCAAT
GGCATGGCCGACAAGATTACCTTGGTCCAAGGGAAAATGGAGGAGGTGGAACTGCCTTTTCCAAGCGTGGACATC
ATCATCTCGGAATGGATGGGCTACTTCTTGCTCTACGAATCCATGCTTGATACCGTTCTCTATGCTCGCGACAAG
TACTTGGTCAAGGGTGGGCTGATATTCCCCGACAAGGCCACCATATTCTTTGCAGGTATCGAGGATGGTGACTAT
AAAGAGGAAAAGATTGGTTTCTGGGATAATGTATATGGCTTCGACTACACACCTCTCAAGGAGACTGCTCTTTCG
GAGCCCCTGGTCGACAATGTTGAGCTCAAGACGGTCGTGACCGACCCCGCCAACGTCCTTACCCTCGACCTTTAT
ACTTGCACCACAGCCGACCTGGCTTTTACCGTGCTCTTCCAGCTCACTGCTAAGCGAGACGACTTTGTTCACGCC
CTCGTGTCCTGGTTTGATATTGATTTTACTGCCTGCCACAAGCAAATTCGCTTTTCTACGGGTCCTCATACAAAA
TACACGCACTGGAAACAGACTGTATTTTACCTGAAGGAGGTGCTCACCGTCCAGCAAGACGAGGAGATAGCCTGC
CAGCTCAACGTTCGTCCCAACAGCAAAAACCGGCGCGACCTTGATATTGAACTTTCGTATCGCCTCGAGACAAGC
GACGTTACCCGCGCGGCTGCTGGCGAATGCGAGTACCACATGTGCTAG
Transcript >OphauB2|7782
ATGGAAGTTGAACAGGCAGAAGAGAGAATGAATGCCCTTGAGCACAGCGAGCAGCATTACTTCAAAAGCTACGAC
CACCATGGTATCCACGAGGAGATGCTGAAAGACGAGGTGCGAACAAGGTCGTACATGAACGCCATTATCCAGAAC
AAGCATCTCTTCAAGGACAAGGTGGTGCTTGATGTCGGCTGCGGGACTGCCATCCTCTCAATGTTCGCCGTCAGG
GCGGGTGCCAAGCACGTCATTGGTGTCGACATGTCATCCATAATTTTCAAGGCAAGGGAAATTGTAAAGGTCAAT
GGCATGGCCGACAAGATTACCTTGGTCCAAGGGAAAATGGAGGAGGTGGAACTGCCTTTTCCAAGCGTGGACATC
ATCATCTCGGAATGGATGGGCTACTTCTTGCTCTACGAATCCATGCTTGATACCGTTCTCTATGCTCGCGACAAG
TACTTGGTCAAGGGTGGGCTGATATTCCCCGACAAGGCCACCATATTCTTTGCAGGTATCGAGGATGGTGACTAT
AAAGAGGAAAAGATTGGTTTCTGGGATAATGTATATGGCTTCGACTACACACCTCTCAAGGAGACTGCTCTTTCG
GAGCCCCTGGTCGACAATGTTGAGCTCAAGACGGTCGTGACCGACCCCGCCAACGTCCTTACCCTCGACCTTTAT
ACTTGCACCACAGCCGACCTGGCTTTTACCGTGCTCTTCCAGCTCACTGCTAAGCGAGACGACTTTGTTCACGCC
CTCGTGTCCTGGTTTGATATTGATTTTACTGCCTGCCACAAGCAAATTCGCTTTTCTACGGGTCCTCATACAAAA
TACACGCACTGGAAACAGACTGTATTTTACCTGAAGGAGGTGCTCACCGTCCAGCAAGACGAGGAGATAGCCTGC
CAGCTCAACGTTCGTCCCAACAGCAAAAACCGGCGCGACCTTGATATTGAACTTTCGTATCGCCTCGAGACAAGC
GACGTTACCCGCGCGGCTGCTGGCGAATGCGAGTACCACATGTGCTAG
Gene >OphauB2|7782
ATGGAAGTTGAACAGGCAGAAGAGAGAATGAATGCCCTTGAGCACAGCGAGCAGCATTACTTCAAAAGGTCAGTC
GCCTCTGGGCGCCCACTCGCCTTTTGGGAGTCGCTTGCGAGATCTTGGGCTGATTACGCTCTTATAGCTACGACC
ACCATGGTACCGTTGCCCATTTATCGTCCCTTATTGACTGCTATCATGGCGACTAACCATGGTGCTACACGCGTC
AAGGTATCCACGAGGAGATGCTGGTACGCAACGCCCCATTCGCGGCAGCATCTTTGCGGCAACGCTGACCGCCTT
GACAGAAAGACGAGGTGCGAACAAGGTCGTACATGAACGCCATTATCCAGAACAAGCATCTCTTCAAGGACAAGG
TGGTGCTTGATGTCGGCTGCGGGACTGCCATCCTCTCAATGTAGGTCGTCTGTGTCGTAAACGCTACAAAACTCG
TCCGATTTAACCTCTGTATCGTCAACAGGTTCGCCGTCAGGGCGGGTGCCAAGCACGTCATTGGTGTCGACATGT
CATCCATAATTTTCAAGGCAAGGGAAATTGTAAAGGTCAATGGCATGGCCGACAAGATTACCTTGGTCCAAGGGA
AAATGGAGGAGGTGGAACTGCCTTTTCCAAGCGTGGACATCATCATCTCGGAATGGATGGGCTACTTCTTGCTCT
ACGAATCCATGCTTGATACCGTTCTCTATGCTCGCGACAAGTACTTGGTCAAGGGTGGGCTGATATTCCCCGACA
AGGCCACCATATTCTTTGCAGGTATCGAGGATGGTGACTATAAAGAGGAAAAGATTGGTTGTGAGTGTTTTGCCC
TGGGCCTCGGTCTGACATGTGCTGATGCCACTCTGCTGTCTGTAGTCTGGGATAATGTATATGGCTTCGACTACA
CACCTCTCAAGGAGACTGCTCTTTCGGAGCCCCTGGTCGACAATGTTGAGCTCAAGACGGTCGTGACCGACCCCG
CCAACGTCCTTACCCTCGACCTTTATACTTGCACCACAGCCGACCTGGCTTTTACCGTGCTCTTCCAGCTCACTG
CTAAGCGAGACGACTTTGTTCACGCCCTCGTGTCCTGGTTTGATATTGATTTTACTGCCTGCCACAAGCAAATTC
GCTTTTCTACGGGTCCTCATACAAAATACACGCACTGGAAACAGACTGTATTTTACCTGAAGGAGGTGCTCACCG
TCCAGCAAGACGAGGAGATAGCCTGCCAGCTCAACGTTCGTCCCAACAGCAAAAACCGGCGCGACCTTGATATTG
AACTTTCGTATCGCCTCGAGACAAGCGACGTTACCCGCGCGGCTGCTGGCGAATGCGAGTACCACATGTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail