Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7778
Gene name
LocationContig_89:7011..8136
Strand-
Gene length (bp)1125
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13181 TPR_8 Tetratricopeptide repeat 2.2E-01 53 84

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C8V3W6|ACL4_EMENI Probable assembly chaperone of rpl4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10433 PE=3 SV=1 14 351 3.0E-89
sp|Q1MTN8|ACL4_SCHPO Probable assembly chaperone of rpl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16D10.01c PE=3 SV=2 12 338 2.0E-37
sp|Q03771|ACL4_YEAST Assembly chaperone of RPL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACL4 PE=1 SV=1 61 283 6.0E-21

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7778
MAPSRPTGTRPTSPDSLLVDAETQLQVGAVDKAILLATQALESTGSGGDHELRALNLLGISHVEAGEIDKARHFL
ERSVKMDEDGMLEERIGGGPEKFLLLAQLSQQGGHDSVQWYQRGAATLRRQLQALVDDTNPTRAQQASIDEKQIR
LGGVLCAVAEVYMTDLSWEQDAEQHCESLVTEAMLIAPQSAETWQTVANVRISQERVHEAKEALRRSLNLWQHLP
PEDPAVPEFPTRVSLARLLLETEMLDEALLVLERLVSDDDESVEAWYLGGWCLFITGQNQKQHRHQHTDDDGWHA
TWATARKWLAQCLKLYARLEYEDERLGEHAVELFQGINKELGEMTQGEEDSWEDCDSQQDELRVGHDDDEEMHD*
Coding >OphauB2|7778
ATGGCGCCGAGCCGGCCGACCGGCACCAGGCCAACGAGTCCCGACTCCCTGCTAGTAGATGCCGAGACACAGCTA
CAGGTGGGCGCCGTCGACAAAGCCATTTTGCTCGCCACCCAAGCGCTGGAGTCGACTGGATCTGGTGGTGACCAC
GAGCTGCGGGCGCTCAATCTCCTGGGCATATCACATGTCGAGGCGGGCGAAATCGATAAAGCTCGCCATTTCCTG
GAGCGATCCGTCAAGATGGATGAGGACGGCATGTTGGAAGAAAGAATTGGCGGCGGTCCAGAAAAGTTCTTGCTG
TTGGCGCAACTGAGCCAACAAGGCGGACACGACAGCGTGCAGTGGTATCAACGCGGCGCGGCCACTCTACGACGC
CAGCTTCAGGCCTTGGTAGACGATACCAATCCGACACGGGCGCAGCAGGCAAGCATAGACGAAAAGCAAATCAGG
CTCGGAGGTGTGCTCTGCGCCGTGGCCGAGGTATACATGACGGACCTGTCGTGGGAGCAAGACGCAGAGCAGCAC
TGCGAATCCCTCGTGACTGAGGCCATGCTCATTGCTCCCCAGTCGGCAGAGACATGGCAGACGGTAGCCAACGTG
CGCATCTCGCAGGAGCGCGTCCACGAGGCCAAAGAAGCGCTGCGACGCAGTCTCAACTTGTGGCAGCACCTGCCG
CCAGAAGACCCCGCTGTCCCCGAGTTCCCAACACGCGTCAGCCTTGCGCGCCTTCTACTCGAGACGGAAATGCTC
GACGAGGCTCTACTGGTTCTGGAGCGACTCGTCTCCGATGATGACGAGAGCGTCGAAGCCTGGTATCTCGGCGGC
TGGTGCCTCTTCATCACGGGCCAGAATCAAAAACAGCACAGGCACCAGCATACTGATGATGATGGGTGGCACGCC
ACATGGGCAACGGCACGAAAATGGCTTGCTCAGTGTCTCAAGCTCTATGCCCGGTTGGAGTACGAAGATGAGCGA
CTGGGCGAACATGCTGTAGAGCTGTTCCAAGGAATCAACAAGGAGCTAGGCGAGATGACCCAAGGAGAGGAGGAC
AGCTGGGAGGATTGCGACAGCCAACAGGATGAGCTTCGAGTTGGCCACGACGATGACGAGGAGATGCACGACTGA
Transcript >OphauB2|7778
ATGGCGCCGAGCCGGCCGACCGGCACCAGGCCAACGAGTCCCGACTCCCTGCTAGTAGATGCCGAGACACAGCTA
CAGGTGGGCGCCGTCGACAAAGCCATTTTGCTCGCCACCCAAGCGCTGGAGTCGACTGGATCTGGTGGTGACCAC
GAGCTGCGGGCGCTCAATCTCCTGGGCATATCACATGTCGAGGCGGGCGAAATCGATAAAGCTCGCCATTTCCTG
GAGCGATCCGTCAAGATGGATGAGGACGGCATGTTGGAAGAAAGAATTGGCGGCGGTCCAGAAAAGTTCTTGCTG
TTGGCGCAACTGAGCCAACAAGGCGGACACGACAGCGTGCAGTGGTATCAACGCGGCGCGGCCACTCTACGACGC
CAGCTTCAGGCCTTGGTAGACGATACCAATCCGACACGGGCGCAGCAGGCAAGCATAGACGAAAAGCAAATCAGG
CTCGGAGGTGTGCTCTGCGCCGTGGCCGAGGTATACATGACGGACCTGTCGTGGGAGCAAGACGCAGAGCAGCAC
TGCGAATCCCTCGTGACTGAGGCCATGCTCATTGCTCCCCAGTCGGCAGAGACATGGCAGACGGTAGCCAACGTG
CGCATCTCGCAGGAGCGCGTCCACGAGGCCAAAGAAGCGCTGCGACGCAGTCTCAACTTGTGGCAGCACCTGCCG
CCAGAAGACCCCGCTGTCCCCGAGTTCCCAACACGCGTCAGCCTTGCGCGCCTTCTACTCGAGACGGAAATGCTC
GACGAGGCTCTACTGGTTCTGGAGCGACTCGTCTCCGATGATGACGAGAGCGTCGAAGCCTGGTATCTCGGCGGC
TGGTGCCTCTTCATCACGGGCCAGAATCAAAAACAGCACAGGCACCAGCATACTGATGATGATGGGTGGCACGCC
ACATGGGCAACGGCACGAAAATGGCTTGCTCAGTGTCTCAAGCTCTATGCCCGGTTGGAGTACGAAGATGAGCGA
CTGGGCGAACATGCTGTAGAGCTGTTCCAAGGAATCAACAAGGAGCTAGGCGAGATGACCCAAGGAGAGGAGGAC
AGCTGGGAGGATTGCGACAGCCAACAGGATGAGCTTCGAGTTGGCCACGACGATGACGAGGAGATGCACGACTGA
Gene >OphauB2|7778
ATGGCGCCGAGCCGGCCGACCGGCACCAGGCCAACGAGTCCCGACTCCCTGCTAGTAGATGCCGAGACACAGCTA
CAGGTGGGCGCCGTCGACAAAGCCATTTTGCTCGCCACCCAAGCGCTGGAGTCGACTGGATCTGGTGGTGACCAC
GAGCTGCGGGCGCTCAATCTCCTGGGCATATCACATGTCGAGGCGGGCGAAATCGATAAAGCTCGCCATTTCCTG
GAGCGATCCGTCAAGATGGATGAGGACGGCATGTTGGAAGAAAGAATTGGCGGCGGTCCAGAAAAGTTCTTGCTG
TTGGCGCAACTGAGCCAACAAGGCGGACACGACAGCGTGCAGTGGTATCAACGCGGCGCGGCCACTCTACGACGC
CAGCTTCAGGCCTTGGTAGACGATACCAATCCGACACGGGCGCAGCAGGCAAGCATAGACGAAAAGCAAATCAGG
CTCGGAGGTGTGCTCTGCGCCGTGGCCGAGGTATACATGACGGACCTGTCGTGGGAGCAAGACGCAGAGCAGCAC
TGCGAATCCCTCGTGACTGAGGCCATGCTCATTGCTCCCCAGTCGGCAGAGACATGGCAGACGGTAGCCAACGTG
CGCATCTCGCAGGAGCGCGTCCACGAGGCCAAAGAAGCGCTGCGACGCAGTCTCAACTTGTGGCAGCACCTGCCG
CCAGAAGACCCCGCTGTCCCCGAGTTCCCAACACGCGTCAGCCTTGCGCGCCTTCTACTCGAGACGGAAATGCTC
GACGAGGCTCTACTGGTTCTGGAGCGACTCGTCTCCGATGATGACGAGAGCGTCGAAGCCTGGTATCTCGGCGGC
TGGTGCCTCTTCATCACGGGCCAGAATCAAAAACAGCACAGGCACCAGCATACTGATGATGATGGGTGGCACGCC
ACATGGGCAACGGCACGAAAATGGCTTGCTCAGTGTCTCAAGCTCTATGCCCGGTTGGAGTACGAAGATGAGCGA
CTGGGCGAACATGCTGTAGAGCTGTTCCAAGGAATCAACAAGGAGCTAGGCGAGATGACCCAAGGAGAGGAGGAC
AGCTGGGAGGATTGCGACAGCCAACAGGATGAGCTTCGAGTTGGCCACGACGATGACGAGGAGATGCACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail