Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7777
Gene name
LocationContig_89:5923..6738
Strand+
Gene length (bp)815
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05773 RWD RWD domain 1.4E-22 5 124
PF16543 DFRP_C DRG Family Regulatory Proteins, Tma46 5.0E-07 147 225

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94721|YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.09c PE=3 SV=1 8 213 2.0E-24
sp|Q03768|GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIR2 PE=1 SV=1 4 239 1.0E-19
sp|Q9CQK7|RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus GN=Rwdd1 PE=1 SV=1 4 209 3.0E-17
sp|Q9H446|RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens GN=RWDD1 PE=1 SV=1 4 209 7.0E-17
sp|Q99ND9|RWDD1_RAT RWD domain-containing protein 1 OS=Rattus norvegicus GN=Rwdd1 PE=2 SV=1 4 209 9.0E-17

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1930
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2812
Ophiocordyceps australis map64 (Brazil) OphauB2|7777 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07356
Ophiocordyceps camponoti-rufipedis Ophun1|6571
Ophiocordyceps kimflemingae Ophio5|6656
Ophiocordyceps subramaniannii Hirsu2|2063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7777
MGLQDQIEEREVLGSIFPDEITDISESEFRISVTLDVPGDEADNEEDDALQPPQFVLHVRYAQDYPDAPPRLDML
APPGALASPHRYFSVSDDREQLLAGLESVMEENLGMAMIFTLVSALKEAAEQLIMDRRAVTAAEIEQSRLAAERE
ENKKFHGTAVTPESFLKWREAFIKEMADKERKQEEERLAELKRAKVKEPVKLTGRQLWERGLAGKGEDGDDDDDA
DDGPPIEGVQKLQVEASS*
Coding >OphauB2|7777
ATGGGGCTCCAGGATCAAATAGAGGAGCGCGAAGTCTTGGGCTCCATTTTCCCTGACGAAATAACCGACATCTCC
GAGTCCGAGTTTCGAATAAGCGTAACGCTCGATGTTCCCGGCGACGAAGCCGACAACGAGGAAGATGACGCCCTG
CAGCCGCCGCAGTTTGTTCTTCACGTTCGCTATGCTCAAGATTATCCCGACGCTCCGCCGCGCCTCGACATGCTG
GCCCCTCCTGGTGCTTTGGCATCACCACATCGCTACTTTAGCGTTTCCGACGACCGAGAACAGCTCCTTGCAGGC
CTGGAGTCTGTCATGGAGGAAAATCTCGGCATGGCTATGATTTTTACTCTGGTCTCGGCCCTCAAGGAGGCGGCG
GAGCAGCTCATCATGGACCGCCGCGCTGTTACTGCCGCAGAAATCGAACAAAGTCGGCTTGCTGCCGAGCGTGAA
GAGAACAAGAAATTCCACGGAACCGCCGTTACACCAGAAAGCTTCTTGAAGTGGCGAGAGGCCTTTATCAAGGAA
ATGGCGGACAAGGAGCGCAAACAAGAAGAGGAACGTTTAGCCGAGCTCAAGCGTGCCAAAGTCAAGGAACCTGTC
AAGCTCACGGGAAGGCAGCTTTGGGAACGTGGTCTAGCGGGCAAGGGCGAGGATGGAGATGACGATGACGACGCT
GACGACGGACCGCCTATCGAGGGTGTCCAGAAACTGCAGGTCGAAGCAAGCTCTTGA
Transcript >OphauB2|7777
ATGGGGCTCCAGGATCAAATAGAGGAGCGCGAAGTCTTGGGCTCCATTTTCCCTGACGAAATAACCGACATCTCC
GAGTCCGAGTTTCGAATAAGCGTAACGCTCGATGTTCCCGGCGACGAAGCCGACAACGAGGAAGATGACGCCCTG
CAGCCGCCGCAGTTTGTTCTTCACGTTCGCTATGCTCAAGATTATCCCGACGCTCCGCCGCGCCTCGACATGCTG
GCCCCTCCTGGTGCTTTGGCATCACCACATCGCTACTTTAGCGTTTCCGACGACCGAGAACAGCTCCTTGCAGGC
CTGGAGTCTGTCATGGAGGAAAATCTCGGCATGGCTATGATTTTTACTCTGGTCTCGGCCCTCAAGGAGGCGGCG
GAGCAGCTCATCATGGACCGCCGCGCTGTTACTGCCGCAGAAATCGAACAAAGTCGGCTTGCTGCCGAGCGTGAA
GAGAACAAGAAATTCCACGGAACCGCCGTTACACCAGAAAGCTTCTTGAAGTGGCGAGAGGCCTTTATCAAGGAA
ATGGCGGACAAGGAGCGCAAACAAGAAGAGGAACGTTTAGCCGAGCTCAAGCGTGCCAAAGTCAAGGAACCTGTC
AAGCTCACGGGAAGGCAGCTTTGGGAACGTGGTCTAGCGGGCAAGGGCGAGGATGGAGATGACGATGACGACGCT
GACGACGGACCGCCTATCGAGGGTGTCCAGAAACTGCAGGTCGAAGCAAGCTCTTGA
Gene >OphauB2|7777
ATGGGGCTCCAGGATCAAATAGAGGAGCGCGAAGTCTTGGGCTCCATTTTCCCTGACGAAATAACCGGTACGTGT
AGCCGCGCCAGTGAGAGTAGCAGCTACAGCAGCCACCAACGATATCCAGGCTCAGATGTGTCTTGTGTGACGCAG
ACATCTCCGAGTCCGAGTTTCGAATAAGCGTAACGCTCGATGTTCCCGGCGACGAAGCCGACAACGAGGAAGATG
ACGCCCTGCAGCCGCCGCAGTTTGTTCTTCACGTTCGCTATGCTCAAGATTATCCCGACGCTCCGCCGCGCCTCG
ACATGCTGGCCCCTCCTGGTGCTTTGGCATCACCACATCGCTACTTTAGCGTTTCCGACGACCGAGAACAGCTCC
TTGCAGGCCTGGAGTCTGTCATGGAGGAAAATCTCGGCATGGCTATGATTTTTACTCTGGTCTCGGCCCTCAAGG
AGGCGGCGGAGCAGCTCATCATGGACCGCCGCGCTGTTACTGCCGCAGAAATCGAACAAAGTCGGCTTGCTGCCG
AGCGTGAAGAGAACAAGAAATTCCACGGAACCGCCGTTACACCAGAAAGCTTCTTGAAGTGGCGAGAGGCCTTTA
TCAAGGAAATGGCGGACAAGGAGCGCAAACAAGAAGAGGAACGTTTAGCCGAGCTCAAGCGTGCCAAAGTCAAGG
AACCTGTCAAGCTCACGGGAAGGCAGCTTTGGGAACGTGGTCTAGCGGGCAAGGGCGAGGATGGAGATGACGATG
ACGACGCTGACGACGGACCGCCTATCGAGGGTGTCCAGAAACTGCAGGTCGAAGCAAGCTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail