Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7770
Gene name
LocationContig_88:69410..70477
Strand-
Gene length (bp)1067
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01302|CCG6_NEUCR Clock-controlled protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccg-6 PE=2 SV=2 34 81 4.0E-15
sp|Q01589|SED1_YEAST Cell wall protein SED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED1 PE=1 SV=1 30 81 9.0E-12
sp|Q01589|SED1_YEAST Cell wall protein SED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED1 PE=1 SV=1 44 82 3.0E-09
sp|P40092|SPI1_YEAST Uncharacterized cell wall protein SPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPI1 PE=2 SV=1 40 85 9.0E-09
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 129 305 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01302|CCG6_NEUCR Clock-controlled protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccg-6 PE=2 SV=2 34 81 4.0E-15
sp|Q01589|SED1_YEAST Cell wall protein SED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED1 PE=1 SV=1 30 81 9.0E-12
sp|Q01589|SED1_YEAST Cell wall protein SED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED1 PE=1 SV=1 44 82 3.0E-09
sp|P40092|SPI1_YEAST Uncharacterized cell wall protein SPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPI1 PE=2 SV=1 40 85 9.0E-09
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 129 305 1.0E-06
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 116 230 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7770
MYKLNAVLASTATLVASASAGVVPNQPRNYNQSVVYTTVVATAYTTYCPSPTEIPMGSVTYTVTEPTTLTITDCP
CTITKPHTPTYAPPPEVSCSEEYPPPANTTPVPAPPPVYTPAPPAPPVNPPAPPAPPVNPPAPAPPAPPAPPANP
PAPPAPPAQPAPPAPPAPPAAPANPPAAPAPPAPPVNAPAPPANPPANPPAAPAPPAPPAETQAPAAPAPPVETQ
APAAPAPPAPPAPPVKSELPAPPPANTAAPVSPPESPPANTVAPPPSSATAAPVLPTAGAERLSAGLGALVVAIV
VAALI*
Coding >OphauB2|7770
ATGTACAAACTCAACGCCGTGTTGGCCTCGACGGCGACGCTGGTGGCCTCGGCCTCGGCGGGCGTCGTGCCCAAC
CAGCCGCGCAACTACAACCAGTCTGTTGTCTATACGACTGTTGTTGCCACGGCTTACACCACTTATTGCCCTTCT
CCCACCGAGATTCCCATGGGCAGCGTCACATACACAGTCACCGAGCCAACCACCCTCACCATCACCGACTGTCCC
TGCACAATCACCAAGCCTCACACGCCAACCTATGCTCCTCCTCCCGAGGTCAGCTGCTCTGAGGAATACCCCCCG
CCAGCCAATACCACGCCTGTCCCTGCGCCGCCGCCAGTCTACACTCCGGCTCCCCCCGCACCTCCCGTCAACCCT
CCAGCTCCCCCAGCGCCTCCAGTCAACCCCCCGGCTCCTGCACCTCCTGCGCCACCAGCTCCTCCGGCCAATCCT
CCAGCTCCCCCTGCGCCACCGGCTCAGCCAGCACCTCCTGCTCCTCCAGCACCGCCTGCTGCTCCCGCAAACCCT
CCTGCTGCCCCTGCGCCCCCTGCACCACCGGTCAACGCCCCTGCCCCTCCCGCAAACCCTCCCGCAAACCCTCCC
GCTGCTCCAGCTCCTCCAGCTCCTCCTGCTGAGACTCAGGCTCCCGCTGCTCCGGCTCCCCCTGTTGAGACTCAG
GCTCCTGCTGCCCCAGCTCCCCCTGCTCCCCCTGCGCCTCCTGTCAAATCTGAGCTCCCTGCCCCTCCTCCCGCC
AACACGGCCGCTCCCGTCTCTCCTCCTGAGTCGCCGCCTGCCAACACCGTCGCTCCTCCTCCTAGCAGCGCTACC
GCTGCGCCAGTCCTGCCAACTGCTGGTGCCGAGCGCCTCAGCGCCGGCCTCGGAGCTCTGGTTGTTGCCATTGTC
GTCGCTGCTCTCATTTGA
Transcript >OphauB2|7770
ATGTACAAACTCAACGCCGTGTTGGCCTCGACGGCGACGCTGGTGGCCTCGGCCTCGGCGGGCGTCGTGCCCAAC
CAGCCGCGCAACTACAACCAGTCTGTTGTCTATACGACTGTTGTTGCCACGGCTTACACCACTTATTGCCCTTCT
CCCACCGAGATTCCCATGGGCAGCGTCACATACACAGTCACCGAGCCAACCACCCTCACCATCACCGACTGTCCC
TGCACAATCACCAAGCCTCACACGCCAACCTATGCTCCTCCTCCCGAGGTCAGCTGCTCTGAGGAATACCCCCCG
CCAGCCAATACCACGCCTGTCCCTGCGCCGCCGCCAGTCTACACTCCGGCTCCCCCCGCACCTCCCGTCAACCCT
CCAGCTCCCCCAGCGCCTCCAGTCAACCCCCCGGCTCCTGCACCTCCTGCGCCACCAGCTCCTCCGGCCAATCCT
CCAGCTCCCCCTGCGCCACCGGCTCAGCCAGCACCTCCTGCTCCTCCAGCACCGCCTGCTGCTCCCGCAAACCCT
CCTGCTGCCCCTGCGCCCCCTGCACCACCGGTCAACGCCCCTGCCCCTCCCGCAAACCCTCCCGCAAACCCTCCC
GCTGCTCCAGCTCCTCCAGCTCCTCCTGCTGAGACTCAGGCTCCCGCTGCTCCGGCTCCCCCTGTTGAGACTCAG
GCTCCTGCTGCCCCAGCTCCCCCTGCTCCCCCTGCGCCTCCTGTCAAATCTGAGCTCCCTGCCCCTCCTCCCGCC
AACACGGCCGCTCCCGTCTCTCCTCCTGAGTCGCCGCCTGCCAACACCGTCGCTCCTCCTCCTAGCAGCGCTACC
GCTGCGCCAGTCCTGCCAACTGCTGGTGCCGAGCGCCTCAGCGCCGGCCTCGGAGCTCTGGTTGTTGCCATTGTC
GTCGCTGCTCTCATTTGA
Gene >OphauB2|7770
ATGTACAAACTCAACGCCGTGTTGGCCTCGACGGCGACGCTGGTGGCCTCGGCCTCGGCGGGCGTCGTGCCCAAC
CAGCCGCGCAACTACAACCAGTCTGTTGTCTATACGACTGTTGTTGCCACGGCTTACACCACTTATTGCCCTGTG
AGTATTTTCGACTCTCTTGTTGTTGTTTTTTCAAAGCCGTGTATCCCTTCTATTCGAGCCGTGTATCCCTCCTAT
TCGAGCCGTCTGCCCTCCTATACGAGCCACTCCCCCAAGCCATGTGCTAACGAGCCTCGTTTGAATATCAGTCTC
CCACCGAGATTCCCATGGGCAGCGTCACATACACAGTCACCGAGCCAACCACCCTCACCATCACCGACTGTCCCT
GCACAATCACCAAGCCTCACACGCCAACCTATGCTCCTCCTCCCGAGGTCAGCTGCTCTGAGGAATACCCCCCGC
CAGCCAATACCACGCCTGTCCCTGCGCCGCCGCCAGTCTACACTCCGGCTCCCCCCGCACCTCCCGTCAACCCTC
CAGCTCCCCCAGCGCCTCCAGTCAACCCCCCGGCTCCTGCACCTCCTGCGCCACCAGCTCCTCCGGCCAATCCTC
CAGCTCCCCCTGCGCCACCGGCTCAGCCAGCACCTCCTGCTCCTCCAGCACCGCCTGCTGCTCCCGCAAACCCTC
CTGCTGCCCCTGCGCCCCCTGCACCACCGGTCAACGCCCCTGCCCCTCCCGCAAACCCTCCCGCAAACCCTCCCG
CTGCTCCAGCTCCTCCAGCTCCTCCTGCTGAGACTCAGGCTCCCGCTGCTCCGGCTCCCCCTGTTGAGACTCAGG
CTCCTGCTGCCCCAGCTCCCCCTGCTCCCCCTGCGCCTCCTGTCAAATCTGAGCTCCCTGCCCCTCCTCCCGCCA
ACACGGCCGCTCCCGTCTCTCCTCCTGAGTCGCCGCCTGCCAACACCGTCGCTCCTCCTCCTAGCAGCGCTACCG
CTGCGCCAGTCCTGCCAACTGCTGGTGCCGAGCGCCTCAGCGCCGGCCTCGGAGCTCTGGTTGTTGCCATTGTCG
TCGCTGCTCTCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail