Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7766
Gene name
LocationContig_88:57856..59090
Strand+
Gene length (bp)1234
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.2E-55 5 297
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.6E-20 6 185
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.3E-08 42 147
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 1.5E-07 48 115
PF07993 NAD_binding_4 Male sterility protein 9.8E-06 64 179
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 4.8E-05 43 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U2R0|MAT2B_RAT Methionine adenosyltransferase 2 subunit beta OS=Rattus norvegicus GN=Mat2b PE=2 SV=1 6 297 6.0E-63
sp|Q99LB6|MAT2B_MOUSE Methionine adenosyltransferase 2 subunit beta OS=Mus musculus GN=Mat2b PE=1 SV=1 6 297 7.0E-63
sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit beta OS=Pongo abelii GN=MAT2B PE=2 SV=1 6 297 3.0E-62
sp|Q9NZL9|MAT2B_HUMAN Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens GN=MAT2B PE=1 SV=1 6 297 3.0E-62
sp|Q29RI9|MAT2B_BOVIN Methionine adenosyltransferase 2 subunit beta OS=Bos taurus GN=MAT2B PE=2 SV=1 6 301 7.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U2R0|MAT2B_RAT Methionine adenosyltransferase 2 subunit beta OS=Rattus norvegicus GN=Mat2b PE=2 SV=1 6 297 6.0E-63
sp|Q99LB6|MAT2B_MOUSE Methionine adenosyltransferase 2 subunit beta OS=Mus musculus GN=Mat2b PE=1 SV=1 6 297 7.0E-63
sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit beta OS=Pongo abelii GN=MAT2B PE=2 SV=1 6 297 3.0E-62
sp|Q9NZL9|MAT2B_HUMAN Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens GN=MAT2B PE=1 SV=1 6 297 3.0E-62
sp|Q29RI9|MAT2B_BOVIN Methionine adenosyltransferase 2 subunit beta OS=Bos taurus GN=MAT2B PE=2 SV=1 6 301 7.0E-62
sp|Q566L8|MAT2B_XENTR Methionine adenosyltransferase 2 subunit beta OS=Xenopus tropicalis GN=mat2b PE=2 SV=1 7 297 5.0E-60
sp|Q4QQZ4|MAT2B_XENLA Methionine adenosyltransferase 2 subunit beta OS=Xenopus laevis GN=mat2b PE=2 SV=1 7 297 2.0E-58
sp|Q5BJJ6|MAT2B_DANRE Methionine adenosyltransferase 2 subunit beta OS=Danio rerio GN=mat2b PE=2 SV=1 6 317 8.0E-57
sp|D4GU71|AGL14_HALVD Probable low-salt glycan biosynthesis reductase Agl14 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl14 PE=3 SV=1 7 171 3.0E-20
sp|A0QTF8|RMLD_MYCS2 dTDP-4-dehydrorhamnose reductase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlD PE=1 SV=1 4 297 1.0E-19
sp|Q9L9E9|NOVS_STRNV dTDP-4-keto-6-deoxy-D-glucose reductase OS=Streptomyces niveus GN=novS PE=3 SV=1 7 267 8.0E-19
sp|P29781|RMLD_STRGR dTDP-4-dehydrorhamnose reductase OS=Streptomyces griseus GN=strL PE=1 SV=1 3 202 4.0E-18
sp|O66251|RMLD_AGGAC dTDP-4-dehydrorhamnose reductase OS=Aggregatibacter actinomycetemcomitans GN=rmlD PE=1 SV=1 1 251 6.0E-15
sp|P39631|SPSK_BACSU Spore coat polysaccharide biosynthesis protein SpsK OS=Bacillus subtilis (strain 168) GN=spsK PE=3 SV=3 6 297 2.0E-14
sp|P26392|RMLD_SALTY dTDP-4-dehydrorhamnose reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbD PE=1 SV=1 54 166 2.0E-14
sp|P37778|RMLD_SHIFL dTDP-4-dehydrorhamnose reductase OS=Shigella flexneri GN=rfbD PE=1 SV=2 6 154 1.0E-13
sp|Q46769|RMLD_ECOLX dTDP-4-dehydrorhamnose reductase OS=Escherichia coli GN=rfbD PE=1 SV=1 6 170 1.0E-12
sp|P37760|RMLD_ECOLI dTDP-4-dehydrorhamnose reductase OS=Escherichia coli (strain K12) GN=rfbD PE=3 SV=2 54 152 6.0E-12
sp|P9WH09|RMLD_MYCTU dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlD PE=1 SV=1 4 155 3.0E-07
sp|P9WH08|RMLD_MYCTO dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlD PE=3 SV=1 4 155 3.0E-07
sp|Q2SYI1|RMLD_BURTA dTDP-4-dehydrorhamnose reductase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rmlD PE=1 SV=1 6 150 9.0E-07
sp|P55463|RMLD_RHISN Probable dTDP-4-dehydrorhamnose reductase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03570 PE=3 SV=1 54 247 1.0E-06
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 5 146 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008610 lipid biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008150 biological_process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7766
MSRQTVLVTGATGLLGRQVATTFRLSGWNVSGLGFSRADGVDIGKVNLEETDQVAEVLDKIKPQAVIHCAAQKSP
DKVDKDPDSARSLNIAASKNLASLAAARDVVMVYISTDYVFPGTPGDAPYEVDATPNPTTLYGKTKLDGEGAVLD
EYARAGKQGSAVVLRVPVLYGNAETPGESAVNVLMDAVWKAQTQGTDMVIDDWALRYPTNTEDVGRICRDVAARY
LDAADRQVLPRILHFSSQDKATKYEICQRFGSIMGLSTANIKAKREGNDPNSSVQRPYDCHLSTKSLEQLGIDVS
TCDFTAWWRREVGAFRK*
Coding >OphauB2|7766
ATGTCTCGGCAAACCGTGCTCGTCACCGGCGCCACAGGCCTGCTGGGGCGACAAGTGGCGACGACGTTTAGGCTC
AGCGGATGGAACGTTAGCGGTCTGGGCTTCTCGCGGGCTGATGGCGTCGACATTGGCAAAGTCAACCTCGAAGAG
ACAGACCAAGTGGCAGAGGTTCTCGACAAGATCAAGCCTCAGGCTGTCATCCACTGCGCCGCCCAAAAGTCTCCC
GACAAGGTCGACAAGGATCCAGACTCCGCCCGGTCTCTCAACATTGCAGCCAGCAAGAACCTTGCCAGTCTGGCT
GCTGCACGAGACGTCGTCATGGTCTACATTTCCACCGACTATGTCTTCCCGGGAACGCCCGGCGATGCCCCGTAC
GAGGTTGACGCCACTCCAAACCCGACCACCCTCTACGGCAAGACAAAGTTGGATGGAGAAGGCGCAGTGCTAGAC
GAGTATGCCCGGGCAGGCAAGCAAGGCTCAGCCGTTGTGCTCCGCGTTCCCGTCTTGTATGGCAATGCAGAGACT
CCGGGGGAGAGCGCAGTCAACGTGCTCATGGATGCCGTGTGGAAAGCCCAGACGCAGGGAACCGACATGGTGATT
GACGACTGGGCTCTGCGCTACCCAACCAACACTGAAGACGTCGGTCGTATCTGCCGCGACGTGGCAGCCAGGTAT
CTCGATGCGGCCGACAGACAAGTCCTGCCGCGCATCCTGCACTTTTCCAGCCAGGATAAGGCAACCAAGTACGAG
ATATGCCAACGATTTGGTAGTATTATGGGCCTATCGACGGCCAACATCAAGGCCAAGAGGGAGGGGAACGACCCT
AATAGCTCGGTGCAGAGGCCATATGATTGCCACCTGAGCACAAAAAGCCTTGAGCAACTTGGCATTGACGTGTCG
ACGTGCGACTTTACCGCATGGTGGCGCAGAGAAGTTGGCGCCTTTCGCAAGTAA
Transcript >OphauB2|7766
ATGTCTCGGCAAACCGTGCTCGTCACCGGCGCCACAGGCCTGCTGGGGCGACAAGTGGCGACGACGTTTAGGCTC
AGCGGATGGAACGTTAGCGGTCTGGGCTTCTCGCGGGCTGATGGCGTCGACATTGGCAAAGTCAACCTCGAAGAG
ACAGACCAAGTGGCAGAGGTTCTCGACAAGATCAAGCCTCAGGCTGTCATCCACTGCGCCGCCCAAAAGTCTCCC
GACAAGGTCGACAAGGATCCAGACTCCGCCCGGTCTCTCAACATTGCAGCCAGCAAGAACCTTGCCAGTCTGGCT
GCTGCACGAGACGTCGTCATGGTCTACATTTCCACCGACTATGTCTTCCCGGGAACGCCCGGCGATGCCCCGTAC
GAGGTTGACGCCACTCCAAACCCGACCACCCTCTACGGCAAGACAAAGTTGGATGGAGAAGGCGCAGTGCTAGAC
GAGTATGCCCGGGCAGGCAAGCAAGGCTCAGCCGTTGTGCTCCGCGTTCCCGTCTTGTATGGCAATGCAGAGACT
CCGGGGGAGAGCGCAGTCAACGTGCTCATGGATGCCGTGTGGAAAGCCCAGACGCAGGGAACCGACATGGTGATT
GACGACTGGGCTCTGCGCTACCCAACCAACACTGAAGACGTCGGTCGTATCTGCCGCGACGTGGCAGCCAGGTAT
CTCGATGCGGCCGACAGACAAGTCCTGCCGCGCATCCTGCACTTTTCCAGCCAGGATAAGGCAACCAAGTACGAG
ATATGCCAACGATTTGGTAGTATTATGGGCCTATCGACGGCCAACATCAAGGCCAAGAGGGAGGGGAACGACCCT
AATAGCTCGGTGCAGAGGCCATATGATTGCCACCTGAGCACAAAAAGCCTTGAGCAACTTGGCATTGACGTGTCG
ACGTGCGACTTTACCGCATGGTGGCGCAGAGAAGTTGGCGCCTTTCGCAAGTAA
Gene >OphauB2|7766
ATGTCTCGGCAAACCGTGCTCGTCACCGGCGCCACAGGCCTGCTGGGGCGACAAGTGGCGACGACGTTTAGGCTC
AGCGGATGGAACGTTAGCGGTCTGGGCTTCTCGCGGGCTGATGGCGTCGACATTGGCAAAGTCAACCTCGAAGAG
ACAGACCAAGTGGCAGAGGTTCTCGACAAGATCAAGTCGGTGATGGATTCCGCAATTATGCGCGAGGCGGCCTGC
TGACCATTTTGTTGTCACTCGTCGGCTGGATAGGCCTCAGGCTGTCATCCACTGCAAGTGGCTGTCCGAATCCCG
ATAGAGCGAGGCTTCAGGCGAGAAATCGGGTGGCTGGCTAACACGACGCCAGGCGCCGCCCAAAAGTCTCCCGAC
AAGGTCGACAAGGATCCAGACTCCGCCCGGTCTCTCAACATTGCAGCCAGCAAGAACCTTGCCAGTCTGGCTGCT
GCACGAGACGTCGTCATGGTCTACATTTCCACCGACTATGTCTTCCCGGGAACGCCCGGCGATGCCCCGTACGAG
GTTGACGCCACTCCAAACCCGACCACCCTCTACGGCAAGACAAAGTTGGATGGAGAAGGCGCAGTGCTAGACGAG
TATGCCCGGGCAGGCAAGCAAGGCTCAGCCGTTGTGCTCCGCGTTCCCGTCTTGTATGGCAATGCAGAGACTCCG
GGGGAGAGCGCAGTCAACGTGCTCATGGATGCCGTGTGGAAAGCCCAGACGCAGGGAACCGACATGGTGATTGAC
GACTGGGCTCTGCGCTACCCAACCAACACTGAAGACGTCGGTCGTATCTGCCGCGGTAAGTATTTGGGCTAGTCG
TCGGCCGTGTCCAGGAGCGCTCGGGCATTGGTGGCTTGCTCGCCGCCGCCGTGCTTATTTGATTGGCAAATGGCA
GTTGTGCAAAGGTCAAGACAGAGCTGATATGTGATTAGACGTGGCAGCCAGGTATCTCGATGCGGCCGACAGACA
AGTCCTGCCGCGCATCCTGCACTTTTCCAGCCAGGATAAGGCAACCAAGTACGAGATATGCCAACGATTTGGTAG
TATTATGGGCCTATCGACGGCCAACATCAAGGCCAAGAGGGAGGGGAACGACCCTAATAGCTCGGTGCAGAGGCC
ATATGATTGCCACCTGAGCACAAAAAGCCTTGAGCAACTTGGCATTGACGTGTCGACGTGCGACTTTACCGCATG
GTGGCGCAGAGAAGTTGGCGCCTTTCGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail