Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7764
Gene name
LocationContig_88:53517..55594
Strand+
Gene length (bp)2077
Transcript length (bp)1956
Coding sequence length (bp)1956
Protein length (aa) 652

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08418 Pol_alpha_B_N DNA polymerase alpha subunit B N-terminal 2.4E-68 18 252
PF04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B 5.8E-42 361 594

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38121|DPOA2_YEAST DNA polymerase alpha subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL12 PE=1 SV=1 8 649 5.0E-92
sp|O74946|DPOA2_SCHPO DNA polymerase alpha subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol12 PE=1 SV=1 23 651 2.0E-88
sp|Q14181|DPOA2_HUMAN DNA polymerase alpha subunit B OS=Homo sapiens GN=POLA2 PE=1 SV=2 164 629 7.0E-50
sp|O89043|DPOA2_RAT DNA polymerase alpha subunit B OS=Rattus norvegicus GN=Pola2 PE=1 SV=2 164 622 2.0E-46
sp|P33611|DPOA2_MOUSE DNA polymerase alpha subunit B OS=Mus musculus GN=Pola2 PE=1 SV=2 164 622 5.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38121|DPOA2_YEAST DNA polymerase alpha subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL12 PE=1 SV=1 8 649 5.0E-92
sp|O74946|DPOA2_SCHPO DNA polymerase alpha subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol12 PE=1 SV=1 23 651 2.0E-88
sp|Q14181|DPOA2_HUMAN DNA polymerase alpha subunit B OS=Homo sapiens GN=POLA2 PE=1 SV=2 164 629 7.0E-50
sp|O89043|DPOA2_RAT DNA polymerase alpha subunit B OS=Rattus norvegicus GN=Pola2 PE=1 SV=2 164 622 2.0E-46
sp|P33611|DPOA2_MOUSE DNA polymerase alpha subunit B OS=Mus musculus GN=Pola2 PE=1 SV=2 164 622 5.0E-44
sp|Q58D13|DPOA2_BOVIN DNA polymerase alpha subunit B OS=Bos taurus GN=POLA2 PE=2 SV=1 164 596 2.0E-39
sp|Q9VB62|DPOA2_DROME DNA polymerase alpha subunit B OS=Drosophila melanogaster GN=DNApol-alpha73 PE=1 SV=2 3 640 3.0E-31
sp|Q21625|DPOA2_CAEEL DNA polymerase alpha subunit B OS=Caenorhabditis elegans GN=div-1 PE=3 SV=3 229 651 2.0E-19
sp|Q54S08|DPOA2_DICDI DNA polymerase alpha subunit B OS=Dictyostelium discoideum GN=polA2 PE=3 SV=2 300 626 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup579
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4145
Ophiocordyceps australis map64 (Brazil) OphauB2|7764 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05878
Ophiocordyceps camponoti-floridani Ophcf2|06458
Ophiocordyceps camponoti-floridani Ophcf2|07449
Ophiocordyceps camponoti-rufipedis Ophun1|7208
Ophiocordyceps kimflemingae Ophio5|454
Ophiocordyceps subramaniannii Hirsu2|6031

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7764
MAETELESRFSPNKALEPDVAAELRSMMRLHELSAEDLFYKWESFCIKMDIDAQDVGLEAVRNLKQNIQDALEKD
QRQQGRSEGQRKAVAATPRAHGGTDMVGMLDGMVPSTPAAGSRKLARPGLGNASASSRKRDREGAFGSSPAGGAR
QGVDEANGSQPYSFKARRHAGQVVEILNERLKAAEAAAGPYGEARIKLTAGSDQKKMAYRPLAMKLSEASEILDD
AIDDFAERVQAHHGLADSAFGSAARQSTAEVVAVGRIASDAGEGRLNAASLVLEMSRRSGMGLRVRLRMERVACW
SFFPGQVVAVRGSNASGSEFVVDEVLSVPLLANAASSQSALAAHRQRLMGTEHDEPAPLSILLASGPYTADDNVD
YEPLDALCSQAAHGHVDALILAGPFVDADHPLVATGSFDLPPDASYSADTATMATVFRFLFAPALNRLASASPHT
TIILVPSVRDVISKHVAWPQDALPRRDLGLPKTARIVSNPMTLSINEVVMGLCSQDILYQLRAEELVQGAPPGDS
KGRLGRYLLEQRHYFPLFPPMDRSRLPKTGTQQGLATGAALDLSYLKLGEMVNVRPDVMLTPSALPPFAMVVESV
LMINPGHLSKRRGAGTFARMSLHAPKLNGDAPDNMVSHQVYDRARVEIVRI*
Coding >OphauB2|7764
ATGGCTGAGACGGAACTCGAGAGTCGGTTCTCGCCCAATAAGGCTCTGGAGCCAGACGTGGCAGCTGAGCTGAGG
TCCATGATGCGGCTGCACGAGCTGTCGGCTGAAGACCTCTTTTACAAATGGGAGTCGTTTTGCATCAAGATGGAT
ATTGATGCGCAAGACGTGGGACTGGAGGCGGTGCGGAATCTCAAGCAAAACATACAAGATGCCTTGGAAAAAGAC
CAGCGACAACAGGGGCGGAGCGAGGGGCAGCGCAAGGCAGTAGCGGCAACACCAAGGGCGCATGGCGGTACAGAT
ATGGTGGGCATGTTGGATGGCATGGTGCCGAGCACGCCGGCTGCTGGGTCGCGGAAGCTGGCGCGACCTGGGCTG
GGCAATGCGAGCGCGTCGAGCAGGAAGAGGGACCGAGAAGGCGCCTTTGGGAGCTCACCGGCAGGCGGCGCGCGG
CAAGGAGTGGACGAGGCCAATGGCTCGCAGCCGTATTCCTTCAAGGCGAGACGGCATGCGGGCCAAGTGGTGGAA
ATCCTCAACGAGCGCCTCAAAGCAGCAGAGGCGGCAGCTGGGCCGTATGGCGAGGCGCGCATCAAGCTGACGGCG
GGGTCGGACCAGAAGAAGATGGCATACCGGCCACTGGCAATGAAGCTGTCGGAGGCGAGCGAGATTCTGGACGAC
GCCATCGACGACTTTGCCGAGCGTGTGCAGGCGCACCACGGGCTGGCCGACTCGGCCTTTGGCAGCGCGGCGAGG
CAGAGCACGGCCGAGGTGGTTGCAGTCGGGCGCATCGCGTCGGACGCGGGCGAGGGCCGGCTCAATGCGGCGTCG
CTGGTGCTGGAGATGTCGCGCCGCAGCGGCATGGGCCTGCGAGTTCGACTGCGCATGGAGCGGGTGGCATGCTGG
AGCTTCTTCCCGGGCCAGGTGGTGGCTGTGCGGGGGAGCAATGCCTCGGGCTCCGAGTTTGTCGTGGACGAGGTG
CTGTCGGTGCCGCTGCTGGCCAATGCGGCGTCGAGCCAGTCGGCGCTGGCGGCCCATCGTCAGCGTCTCATGGGC
ACCGAGCATGACGAGCCGGCGCCGCTCAGCATCTTGCTGGCATCGGGCCCATATACCGCCGACGACAATGTCGAC
TACGAGCCGCTAGACGCGCTGTGCTCCCAGGCTGCCCATGGCCATGTCGACGCCCTCATCCTCGCCGGCCCCTTT
GTCGACGCCGACCACCCCCTCGTTGCCACGGGCAGCTTTGACCTGCCGCCCGACGCATCCTACAGTGCCGACACG
GCAACCATGGCCACCGTCTTTCGCTTCCTCTTTGCCCCGGCGCTCAACCGCCTCGCCTCGGCCAGCCCCCACACT
ACCATTATCCTGGTGCCCTCGGTGCGCGACGTCATTTCCAAGCACGTCGCATGGCCGCAAGACGCCCTGCCGCGT
CGCGACCTCGGCCTGCCCAAGACGGCGCGCATCGTGTCCAATCCCATGACGCTCTCCATCAACGAAGTCGTCATG
GGCCTCTGCAGCCAAGACATTCTCTACCAGCTGCGCGCCGAGGAGCTGGTACAGGGCGCACCTCCCGGCGACTCC
AAGGGCCGCCTGGGCCGATATCTGCTCGAGCAGCGACACTATTTCCCCCTTTTTCCCCCCATGGACCGCTCCAGA
CTGCCCAAGACGGGCACCCAGCAGGGCCTTGCCACGGGCGCTGCGCTCGACTTGAGCTATCTCAAGCTCGGCGAA
ATGGTCAATGTGCGCCCAGATGTCATGCTGACGCCCAGTGCGTTGCCGCCCTTTGCCATGGTTGTGGAAAGCGTC
CTCATGATTAACCCGGGCCATCTCTCCAAGCGCAGAGGAGCAGGCACATTTGCTCGCATGAGCTTGCATGCGCCA
AAGCTAAATGGCGACGCGCCCGACAACATGGTTAGTCACCAAGTCTACGACCGAGCCCGAGTCGAAATTGTAAGG
ATATGA
Transcript >OphauB2|7764
ATGGCTGAGACGGAACTCGAGAGTCGGTTCTCGCCCAATAAGGCTCTGGAGCCAGACGTGGCAGCTGAGCTGAGG
TCCATGATGCGGCTGCACGAGCTGTCGGCTGAAGACCTCTTTTACAAATGGGAGTCGTTTTGCATCAAGATGGAT
ATTGATGCGCAAGACGTGGGACTGGAGGCGGTGCGGAATCTCAAGCAAAACATACAAGATGCCTTGGAAAAAGAC
CAGCGACAACAGGGGCGGAGCGAGGGGCAGCGCAAGGCAGTAGCGGCAACACCAAGGGCGCATGGCGGTACAGAT
ATGGTGGGCATGTTGGATGGCATGGTGCCGAGCACGCCGGCTGCTGGGTCGCGGAAGCTGGCGCGACCTGGGCTG
GGCAATGCGAGCGCGTCGAGCAGGAAGAGGGACCGAGAAGGCGCCTTTGGGAGCTCACCGGCAGGCGGCGCGCGG
CAAGGAGTGGACGAGGCCAATGGCTCGCAGCCGTATTCCTTCAAGGCGAGACGGCATGCGGGCCAAGTGGTGGAA
ATCCTCAACGAGCGCCTCAAAGCAGCAGAGGCGGCAGCTGGGCCGTATGGCGAGGCGCGCATCAAGCTGACGGCG
GGGTCGGACCAGAAGAAGATGGCATACCGGCCACTGGCAATGAAGCTGTCGGAGGCGAGCGAGATTCTGGACGAC
GCCATCGACGACTTTGCCGAGCGTGTGCAGGCGCACCACGGGCTGGCCGACTCGGCCTTTGGCAGCGCGGCGAGG
CAGAGCACGGCCGAGGTGGTTGCAGTCGGGCGCATCGCGTCGGACGCGGGCGAGGGCCGGCTCAATGCGGCGTCG
CTGGTGCTGGAGATGTCGCGCCGCAGCGGCATGGGCCTGCGAGTTCGACTGCGCATGGAGCGGGTGGCATGCTGG
AGCTTCTTCCCGGGCCAGGTGGTGGCTGTGCGGGGGAGCAATGCCTCGGGCTCCGAGTTTGTCGTGGACGAGGTG
CTGTCGGTGCCGCTGCTGGCCAATGCGGCGTCGAGCCAGTCGGCGCTGGCGGCCCATCGTCAGCGTCTCATGGGC
ACCGAGCATGACGAGCCGGCGCCGCTCAGCATCTTGCTGGCATCGGGCCCATATACCGCCGACGACAATGTCGAC
TACGAGCCGCTAGACGCGCTGTGCTCCCAGGCTGCCCATGGCCATGTCGACGCCCTCATCCTCGCCGGCCCCTTT
GTCGACGCCGACCACCCCCTCGTTGCCACGGGCAGCTTTGACCTGCCGCCCGACGCATCCTACAGTGCCGACACG
GCAACCATGGCCACCGTCTTTCGCTTCCTCTTTGCCCCGGCGCTCAACCGCCTCGCCTCGGCCAGCCCCCACACT
ACCATTATCCTGGTGCCCTCGGTGCGCGACGTCATTTCCAAGCACGTCGCATGGCCGCAAGACGCCCTGCCGCGT
CGCGACCTCGGCCTGCCCAAGACGGCGCGCATCGTGTCCAATCCCATGACGCTCTCCATCAACGAAGTCGTCATG
GGCCTCTGCAGCCAAGACATTCTCTACCAGCTGCGCGCCGAGGAGCTGGTACAGGGCGCACCTCCCGGCGACTCC
AAGGGCCGCCTGGGCCGATATCTGCTCGAGCAGCGACACTATTTCCCCCTTTTTCCCCCCATGGACCGCTCCAGA
CTGCCCAAGACGGGCACCCAGCAGGGCCTTGCCACGGGCGCTGCGCTCGACTTGAGCTATCTCAAGCTCGGCGAA
ATGGTCAATGTGCGCCCAGATGTCATGCTGACGCCCAGTGCGTTGCCGCCCTTTGCCATGGTTGTGGAAAGCGTC
CTCATGATTAACCCGGGCCATCTCTCCAAGCGCAGAGGAGCAGGCACATTTGCTCGCATGAGCTTGCATGCGCCA
AAGCTAAATGGCGACGCGCCCGACAACATGGTTAGTCACCAAGTCTACGACCGAGCCCGAGTCGAAATTGTAAGG
ATATGA
Gene >OphauB2|7764
ATGGCTGAGACGGAACTCGAGAGTCGGTTCTCGCCCAATAAGGCTCTGGAGCCAGACGTGGCAGCTGAGCTGAGG
TCCATGATGCGGCTGCACGAGCTGTCGGCTGAAGACCTCTTTTACAAATGGGAGTCGTTTTGCATCAAGATGGAT
ATTGATGCGCAAGACGTGGGACTGGAGGCGGTGCGGAATCTCAAGCAAAACATACAAGATGCCTTGGAAAAAGAC
CAGCGACAACAGGGGCGGAGCGAGGGGCAGCGCAAGGCAGTAGCGGCAACACCAAGGGCGCATGGCGGTACAGAT
ATGGTGGGCATGTTGGATGGCATGGTGCCGAGCACGCCGGCTGCTGGGTCGCGGAAGCTGGCGCGACCTGGGCTG
GGCAATGCGAGCGCGTCGAGCAGGAAGAGGGACCGAGAAGGCGCCTTTGGGAGCTCACCGGCAGGCGGCGCGCGG
CAAGGAGTGGACGAGGCCAATGGCTCGCAGTAAGTATGGTGTGTCAGTCGCGGCAGAGGGGCGGGGGCTCACGTG
TTTGCAGGCCGTATTCCTTCAAGGCGAGACGGCATGCGGGCCAAGTGGTGGAAATCCTCAACGAGCGCCTCAAAG
CAGCAGAGGCGGCAGCTGGGCCGTATGGCGAGGCGCGCATCAAGCTGACGGCGGGGTCGGACCAGAAGAAGATGG
CATACCGGCCACTGGCAATGAAGCTGTCGGAGGCGAGCGAGATTCTGGACGACGCCATCGACGACTTTGCCGAGC
GTGTGCAGGCGCACCACGGGCTGGCCGACTCGGCCTTTGGCAGCGCGGCGAGGCAGAGCACGGCCGAGGTGGTTG
CAGTCGGGCGCATCGCGTCGGACGCGGGCGAGGGCCGGCTCAATGCGGCGTCGCTGGTGCTGGAGATGTCGCGCC
GCAGCGGCATGGGCCTGCGAGTTCGACTGCGCATGGAGCGGGTGGCATGCTGGAGCTTCTTCCCGGGCCAGGTGG
TGGCTGTGCGGGGGAGCAATGCCTCGGGCTCCGAGTTTGTCGTGGACGAGGTGCTGTCGGTGCCGCTGCTGGCCA
ATGCGGCGTCGAGCCAGTCGGCGCTGGCGGCCCATCGTCAGCGTCTCATGGGCACCGAGCATGACGAGCCGGCGC
CGCTCAGCATCTTGCTGGCATCGGGCCCATATACCGCCGACGACAATGTCGACTACGAGCCGCTAGACGCGCTGT
GCTCCCAGGCTGCCCATGGCCATGTCGACGCCCTCATCCTCGCCGGCCCCTTTGTCGACGCCGACCACCCCCTCG
TTGCCACGGGCAGCTTTGACCTGCCGCCCGACGCATCCTACAGTGCCGACACGGCAACCATGGCCACCGTCTTTC
GCTTCCTCTTTGCCCCGGCGCTCAACCGCCTCGCCTCGGCCAGCCCCCACACTACCATTATCCTGGTGCCCTCGG
TGCGCGACGTCATTTCCAAGCACGTCGCATGGCCGCAAGACGCCCTGCCGCGTCGCGACCTCGGCCTGCCCAAGA
CGGCGCGCATCGTGTCCAATCCCATGACGCTCTCCATCAACGAAGTCGTCATGGGCCTCTGCAGCCAAGACATTC
TCTACCAGCTGCGCGCCGAGGAGCTGGTACAGGGCGCACCTCCCGGCGACTCCAAGGGCCGCCTGGGCCGATATC
TGCTCGAGCAGCGACACTATTTCCCCCTTTTTCCCCCCATGGACCGCTCCAGACTGCCCAAGACGGGCACCCAGC
AGGGCCTTGCCACGGGCGCTGCGCTCGACTTGAGCTATCTCAAGCTCGGCGAAATGGTCAATGTGCGCCCAGATG
TCATGCTGACGCCCAGTGCGTTGCCGCCCTTTGCCATGGTGAGAAGAAGAAGAAGCCAACTCGATCTGCACAAGT
CTTGGTACATGGGGCTAACTGTGTGTGGCAGGTTGTGGAAAGCGTCCTCATGATTAACCCGGGCCATCTCTCCAA
GCGCAGAGGAGCAGGCACATTTGCTCGCATGAGCTTGCATGCGCCAAAGCTAAATGGCGACGCGCCCGACAACAT
GGTTAGTCACCAAGTCTACGACCGAGCCCGAGTCGAAATTGTAAGGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail