Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7760
Gene name
LocationContig_88:41304..42800
Strand+
Gene length (bp)1496
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 2.6E-154 31 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 20 447 2.0E-135
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 8 428 7.0E-135
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 22 455 1.0E-122
sp|O74556|YCZ2_SCHPO Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.02 PE=3 SV=1 5 415 3.0E-116
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 20 455 2.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 20 447 2.0E-135
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 8 428 7.0E-135
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 22 455 1.0E-122
sp|O74556|YCZ2_SCHPO Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.02 PE=3 SV=1 5 415 3.0E-116
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 20 455 2.0E-111
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 7 455 2.0E-107
sp|Q5ACZ2|DFG5_CANAL Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFG5 PE=1 SV=1 14 455 2.0E-107
sp|Q9P6I3|YHG7_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.07c PE=3 SV=2 26 443 2.0E-98
sp|Q9P6I4|YHG6_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.06c PE=3 SV=1 20 451 7.0E-76
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999597

Transmembrane Domains

Domain # Start End Length
1 433 455 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH76 5.0E-111 30 394

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|851
Ophiocordyceps australis 1348a (Ghana) OphauG2|5443
Ophiocordyceps australis 1348a (Ghana) OphauG2|4774
Ophiocordyceps australis 1348a (Ghana) OphauG2|4766
Ophiocordyceps australis 1348a (Ghana) OphauG2|1899
Ophiocordyceps australis map64 (Brazil) OphauB2|7760 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|3901
Ophiocordyceps australis map64 (Brazil) OphauB2|3420
Ophiocordyceps australis map64 (Brazil) OphauB2|2008
Ophiocordyceps camponoti-floridani Ophcf2|00987
Ophiocordyceps camponoti-floridani Ophcf2|06598
Ophiocordyceps camponoti-floridani Ophcf2|06757
Ophiocordyceps camponoti-floridani Ophcf2|06881
Ophiocordyceps camponoti-floridani Ophcf2|03911
Ophiocordyceps camponoti-floridani Ophcf2|02543
Ophiocordyceps camponoti-rufipedis Ophun1|305
Ophiocordyceps camponoti-rufipedis Ophun1|3601
Ophiocordyceps camponoti-rufipedis Ophun1|4119
Ophiocordyceps camponoti-rufipedis Ophun1|5000
Ophiocordyceps camponoti-rufipedis Ophun1|6482
Ophiocordyceps camponoti-rufipedis Ophun1|5419
Ophiocordyceps kimflemingae Ophio5|3601
Ophiocordyceps kimflemingae Ophio5|3900
Ophiocordyceps kimflemingae Ophio5|5653
Ophiocordyceps kimflemingae Ophio5|7279
Ophiocordyceps kimflemingae Ophio5|8067
Ophiocordyceps kimflemingae Ophio5|971
Ophiocordyceps subramaniannii Hirsu2|9651
Ophiocordyceps subramaniannii Hirsu2|923
Ophiocordyceps subramaniannii Hirsu2|6764
Ophiocordyceps subramaniannii Hirsu2|3862
Ophiocordyceps subramaniannii Hirsu2|3585
Ophiocordyceps subramaniannii Hirsu2|266
Ophiocordyceps subramaniannii Hirsu2|2507
Ophiocordyceps subramaniannii Hirsu2|10632

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7760
MRGIITTVALAAGLLGSNVHGIQVNVDDDASIKRAAGTAAFGLMKYYTGNNTGDVPGNLPDPYYWWTAGAMFGTI
IDYWFLTGDSSYNDATMQAIIHQGSDTGDFMPKNQTRTEGNDDQGFWAMTAMSAAENKFPDPPSDKPQYLALVQA
VFNQYAQRWDVDDCGGGLRWQIFSFNNGYDYKNSISNGCFFNIAARLARYTGNSTYSEWANKIFDWEQKVGLIDN
NLEVLDGVTITPDKQCRRIDQLQWSYNNGIHLHGAAMMYNLTGSDLWKTRVDGMLKVTTNKFLKDGILFEQFCEP
NRCNRDQQGFKGFLARWLASTSKVAPHTAGTINPILRSTAQAAAASCTGSPASGFLGQPGTACGFDWTRKSFDGL
VGVPPQMNAVSALIYPLAAKGGSPFTEKTGGTSKGNPEAGSGKERDPTALSPITTMDRVGAGFITVLFIVGCLGG
TSFLVT*
Coding >OphauB2|7760
ATGAGAGGCATCATTACCACAGTGGCATTAGCCGCTGGCCTCCTTGGATCAAATGTCCACGGCATCCAAGTCAAT
GTTGATGATGACGCCTCCATCAAGAGAGCCGCCGGCACTGCTGCCTTTGGCCTTATGAAGTACTACACTGGCAAC
AATACTGGCGACGTGCCCGGAAATCTTCCAGACCCCTACTATTGGTGGACTGCCGGTGCCATGTTTGGCACCATC
ATCGACTACTGGTTTCTCACTGGAGACAGCTCTTACAACGACGCCACGATGCAAGCAATCATTCACCAGGGCTCA
GACACAGGCGACTTCATGCCTAAAAACCAGACGCGTACAGAAGGCAACGACGATCAGGGCTTCTGGGCCATGACT
GCCATGAGTGCGGCTGAGAACAAATTCCCCGATCCTCCATCAGATAAGCCTCAGTACCTGGCTCTCGTTCAGGCC
GTCTTCAACCAGTATGCTCAGAGGTGGGACGTGGACGACTGTGGAGGCGGCTTGCGCTGGCAAATCTTCTCCTTC
AATAACGGTTACGACTATAAAAATTCAATTTCCAACGGCTGCTTCTTCAATATCGCCGCCCGCCTAGCCCGATAC
ACGGGCAATAGCACCTATAGCGAATGGGCCAACAAGATTTTTGATTGGGAGCAAAAGGTTGGCCTCATCGACAAT
AATCTCGAGGTTCTCGACGGCGTCACCATCACCCCCGACAAGCAGTGCCGTCGCATCGATCAGCTACAGTGGTCT
TACAACAACGGCATACATCTTCATGGCGCAGCCATGATGTACAATTTGACGGGCAGCGACTTGTGGAAGACACGC
GTTGACGGCATGCTCAAGGTGACGACTAACAAATTCCTCAAGGACGGCATACTCTTTGAGCAGTTCTGCGAACCG
AATCGCTGCAATCGTGACCAACAGGGATTCAAGGGCTTTCTCGCCCGCTGGCTCGCCTCCACGTCCAAAGTCGCC
CCCCATACGGCCGGTACCATCAACCCAATTCTTCGCTCCACTGCCCAAGCTGCTGCCGCTTCATGCACTGGATCA
CCTGCCTCTGGATTTCTTGGCCAGCCTGGAACTGCCTGTGGTTTTGACTGGACGCGCAAATCCTTCGACGGCCTT
GTGGGCGTGCCCCCTCAAATGAATGCTGTTTCGGCCTTGATATATCCCCTAGCTGCCAAGGGCGGCTCGCCTTTT
ACTGAAAAGACTGGCGGCACTTCCAAGGGCAACCCGGAAGCTGGCTCGGGCAAGGAGAGAGACCCAACCGCACTA
AGCCCAATAACAACAATGGATCGTGTCGGTGCCGGCTTCATCACCGTATTGTTCATTGTTGGCTGCTTGGGCGGA
ACTTCGTTCTTGGTAACCTAG
Transcript >OphauB2|7760
ATGAGAGGCATCATTACCACAGTGGCATTAGCCGCTGGCCTCCTTGGATCAAATGTCCACGGCATCCAAGTCAAT
GTTGATGATGACGCCTCCATCAAGAGAGCCGCCGGCACTGCTGCCTTTGGCCTTATGAAGTACTACACTGGCAAC
AATACTGGCGACGTGCCCGGAAATCTTCCAGACCCCTACTATTGGTGGACTGCCGGTGCCATGTTTGGCACCATC
ATCGACTACTGGTTTCTCACTGGAGACAGCTCTTACAACGACGCCACGATGCAAGCAATCATTCACCAGGGCTCA
GACACAGGCGACTTCATGCCTAAAAACCAGACGCGTACAGAAGGCAACGACGATCAGGGCTTCTGGGCCATGACT
GCCATGAGTGCGGCTGAGAACAAATTCCCCGATCCTCCATCAGATAAGCCTCAGTACCTGGCTCTCGTTCAGGCC
GTCTTCAACCAGTATGCTCAGAGGTGGGACGTGGACGACTGTGGAGGCGGCTTGCGCTGGCAAATCTTCTCCTTC
AATAACGGTTACGACTATAAAAATTCAATTTCCAACGGCTGCTTCTTCAATATCGCCGCCCGCCTAGCCCGATAC
ACGGGCAATAGCACCTATAGCGAATGGGCCAACAAGATTTTTGATTGGGAGCAAAAGGTTGGCCTCATCGACAAT
AATCTCGAGGTTCTCGACGGCGTCACCATCACCCCCGACAAGCAGTGCCGTCGCATCGATCAGCTACAGTGGTCT
TACAACAACGGCATACATCTTCATGGCGCAGCCATGATGTACAATTTGACGGGCAGCGACTTGTGGAAGACACGC
GTTGACGGCATGCTCAAGGTGACGACTAACAAATTCCTCAAGGACGGCATACTCTTTGAGCAGTTCTGCGAACCG
AATCGCTGCAATCGTGACCAACAGGGATTCAAGGGCTTTCTCGCCCGCTGGCTCGCCTCCACGTCCAAAGTCGCC
CCCCATACGGCCGGTACCATCAACCCAATTCTTCGCTCCACTGCCCAAGCTGCTGCCGCTTCATGCACTGGATCA
CCTGCCTCTGGATTTCTTGGCCAGCCTGGAACTGCCTGTGGTTTTGACTGGACGCGCAAATCCTTCGACGGCCTT
GTGGGCGTGCCCCCTCAAATGAATGCTGTTTCGGCCTTGATATATCCCCTAGCTGCCAAGGGCGGCTCGCCTTTT
ACTGAAAAGACTGGCGGCACTTCCAAGGGCAACCCGGAAGCTGGCTCGGGCAAGGAGAGAGACCCAACCGCACTA
AGCCCAATAACAACAATGGATCGTGTCGGTGCCGGCTTCATCACCGTATTGTTCATTGTTGGCTGCTTGGGCGGA
ACTTCGTTCTTGGTAACCTAG
Gene >OphauB2|7760
ATGAGAGGCATCATTACCACAGTGGCATTAGCCGCTGGCCTCCTTGGATCAAATGTCCACGGCATCCAAGTCAAT
GTTGATGATGACGGTACGTCACACCCTCGTCCCCTTGTCTGTTTACCTCGACTGGTACTGACCTGGCCTGTTTTT
GAAAGCCTCCATCAAGAGAGCCGCCGGCACTGCTGCCTTTGGCCTTATGAAGTACTACACTGGCAACAATACTGG
CGACGTGCCCGGAAATCTTCCAGACCCCTACTATTGTTCGTTGATCCTCAAGTTGACGAGATGCCAAGCCATTTA
CTTACACTGTAAATGCAGGGTGGACTGCCGGTGCCATGTTTGGCACCATCATCGACTACTGGTTTCTCACTGGAG
ACAGCTCTTACAACGACGCCACGATGCAAGCAATCATTCACCAGGGCTCAGACACAGGCGACTTCATGCCTAAAA
ACCAGACGCGTACAGAAGGCAACGACGATCAGGGCTTCTGGGCCATGACTGCCATGAGTGCGGCTGAGAACAAAT
TCCCCGATCCTCCATCAGATAAGCCTCAGTACCTGGCTCTCGTTCAGGCCGTCTTCAACCAGTATGCTCAGAGGT
GGGACGTGGACGACTGTGGAGGCGGCTTGCGCTGGCAAATCTTCTCCTTCAATAACGGTTACGACTATAAAAATT
CAATTTCCAACGGCTGCTTCTTCAATATCGCCGCCCGCCTAGCCCGATACACGGGCAATAGCACCTATAGCGAAT
GGGCCAACAAGATTTTTGATTGGGAGCAAAAGGTTGGCCTCATCGACAATAATCTCGAGGTTCTCGACGGCGTCA
CCATCACCCCCGACAAGCAGTGCCGTCGCATCGATCAGCTACAGTGGTCTTACAACAACGGCATACATCTTCATG
GCGCAGCCATGATGTACAATTTGACGGGCAGCGACTTGTGGAAGACACGCGTTGACGGCATGCTCAAGGTGACGA
CTAACAAATTCCTCAAGGACGGCATACTCTTTGAGCAGTTCTGCGAACCGAATCGCTGCAATCGTGACCAACAGG
GATTCAAGGGCTTTCTCGCCCGCTGGCTCGCCTCCACGTCCAAAGTCGCCCCCCATACGGCCGGTACCATCAACC
CAATTCTTCGCTCCACTGCCCAAGCTGCTGCCGCTTCATGCACTGGATCACCTGCCTCTGGATTTCTTGGCCAGC
CTGGAACTGCCTGTGGTTTTGACTGGACGCGCAAATCCTTCGACGGCCTTGTGGGCGTGCCCCCTCAAATGAATG
CTGTTTCGGCCTTGATATATCCCCTAGCTGCCAAGGGCGGCTCGCCTTTTACTGAAAAGACTGGCGGCACTTCCA
AGGGCAACCCGGAAGCTGGCTCGGGCAAGGAGAGAGACCCAACCGCACTAAGCCCAATAACAACAATGGATCGTG
TCGGTGCCGGCTTCATCACCGTATTGTTCATTGTTGGCTGCTTGGGCGGAACTTCGTTCTTGGTAACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail