Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7756
Gene name
LocationContig_88:29970..31453
Strand-
Gene length (bp)1483
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 2.2E-20 1 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C8A3|DNLI4_YARLI DNA ligase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIG4 PE=3 SV=1 1 229 1.0E-13
sp|A0RWD6|DNLI_CENSY DNA ligase OS=Cenarchaeum symbiosum (strain A) GN=lig PE=3 SV=2 1 226 3.0E-11
sp|P52496|DNLI4_CANAL DNA ligase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG4 PE=2 SV=3 1 219 8.0E-10
sp|Q08387|DNLI4_YEAST DNA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNL4 PE=1 SV=1 1 219 1.0E-09
sp|Q9HJ26|DNLI_THEAC DNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lig PE=3 SV=1 2 228 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C8A3|DNLI4_YARLI DNA ligase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIG4 PE=3 SV=1 1 229 1.0E-13
sp|A0RWD6|DNLI_CENSY DNA ligase OS=Cenarchaeum symbiosum (strain A) GN=lig PE=3 SV=2 1 226 3.0E-11
sp|P52496|DNLI4_CANAL DNA ligase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG4 PE=2 SV=3 1 219 8.0E-10
sp|Q08387|DNLI4_YEAST DNA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNL4 PE=1 SV=1 1 219 1.0E-09
sp|Q9HJ26|DNLI_THEAC DNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lig PE=3 SV=1 2 228 2.0E-08
sp|Q5BH83|DNLI4_EMENI DNA ligase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lig4 PE=3 SV=1 1 365 2.0E-08
sp|Q6CSH0|DNLI4_KLULA DNA ligase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LIG4 PE=3 SV=1 1 361 2.0E-08
sp|Q8TSR7|DNLI1_METAC DNA ligase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig1 PE=3 SV=1 2 378 1.0E-07
sp|Q75CA4|DNLI4_ASHGO DNA ligase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LIG4 PE=3 SV=1 1 219 2.0E-07
sp|Q1DKE7|DNLI4_COCIM DNA ligase 4 OS=Coccidioides immitis (strain RS) GN=LIG4 PE=3 SV=1 1 226 7.0E-07
sp|B1L3V2|DNLI2_KORCO DNA ligase 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig2 PE=3 SV=1 2 231 8.0E-07
sp|Q9LL84|DNLI4_ARATH DNA ligase 4 OS=Arabidopsis thaliana GN=LIG4 PE=1 SV=1 2 212 3.0E-06
sp|P12000|DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1 2 244 4.0E-06
sp|Q9W1H4|DNLI1_DROME DNA ligase 1 OS=Drosophila melanogaster GN=DNA-ligI PE=1 SV=2 2 261 8.0E-06
sp|Q8PVR7|DNLI1_METMA DNA ligase 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig1 PE=3 SV=1 2 361 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006310 DNA recombination Yes
GO:0005524 ATP binding Yes
GO:0006281 DNA repair Yes
GO:0003910 DNA ligase (ATP) activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0003909 DNA ligase activity No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0032553 ribonucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0033554 cellular response to stress No
GO:0000166 nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0030554 adenyl nucleotide binding No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0050896 response to stimulus No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008152 metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7756
MDGEYCQIHVDAAHGPPRIQIFSKSGKDSTEDRVGLHDTIAQSLKLGSLDCKVRKQCILEGELVVYSDKENKILP
FHKIRNHVSRRGLFLNVEQDSPPRDCEHLMIIYFDILLLDDDSLLATRHSERFKILERIVSQRQGWSELIQRQVI
DFRSHYASSDLRNAFASIIVAKDEGLVLKPDEPYFNLEGFNKSLAGCCIKLKKEYIGNFGDVGDFAVVGAGFNAA
KAKSYNIPNVKWTHFFIGCITNKEKAKNPQINSEFTVVNVVELNKTQIGTLLKFGTPLPLSVSENKAIKVQVPRG
IDTSTPMTVIFQNPLVFDLRCFSFDKPGNVGFWTLRFPVVSKIHFDRDYTDTVSFDELQQMAKEATTIPEVKDSQ
ENLAWVAKLESADPMDSNLDAIKYKCLCLAYDSQASSTSLQIFDTTWAN*
Coding >OphauB2|7756
ATGGATGGCGAGTACTGCCAGATACACGTTGATGCTGCGCACGGCCCACCACGCATCCAAATCTTCTCCAAGAGT
GGCAAAGATAGCACTGAAGATAGAGTGGGATTGCACGACACCATTGCTCAATCGCTCAAACTTGGCTCTCTCGAT
TGTAAAGTTCGCAAACAGTGCATCCTCGAAGGGGAGCTTGTTGTCTACAGCGACAAGGAAAACAAGATTCTTCCT
TTTCACAAAATACGAAACCATGTATCGCGCCGAGGCTTATTCCTGAATGTAGAACAGGACTCTCCGCCACGGGAC
TGCGAACACCTTATGATTATATATTTCGACATCTTGCTCCTAGACGATGATTCTCTCTTGGCCACTCGCCACTCT
GAGAGGTTCAAAATTCTTGAAAGAATAGTTTCGCAACGTCAAGGGTGGTCCGAGTTGATTCAAAGACAAGTCATC
GACTTCCGAAGCCACTATGCATCTTCTGATTTGAGGAACGCTTTCGCTAGCATTATTGTGGCAAAGGATGAGGGA
CTGGTACTGAAGCCAGACGAGCCATACTTCAATCTCGAAGGGTTCAACAAGTCACTTGCAGGCTGCTGTATCAAA
CTGAAGAAGGAATACATTGGTAACTTTGGCGATGTTGGTGACTTTGCCGTTGTCGGGGCAGGCTTCAATGCTGCC
AAGGCCAAGTCATACAACATCCCAAATGTGAAATGGACCCACTTCTTCATCGGCTGCATCACGAACAAAGAAAAA
GCCAAGAACCCCCAGATCAATTCAGAGTTTACTGTCGTCAATGTCGTTGAGCTCAACAAGACGCAAATTGGAACA
CTTCTGAAGTTCGGAACGCCTCTACCACTTTCGGTCTCGGAAAACAAGGCAATCAAGGTGCAAGTTCCTCGAGGC
ATCGATACAAGCACACCAATGACTGTCATCTTTCAGAACCCGCTCGTCTTTGACCTTAGATGCTTCAGTTTCGAT
AAACCTGGAAACGTCGGGTTCTGGACACTGCGATTTCCAGTTGTCAGCAAAATTCACTTTGATCGCGACTACACA
GACACTGTTTCGTTTGATGAATTGCAGCAAATGGCCAAAGAGGCCACCACAATTCCTGAGGTGAAAGATAGTCAG
GAGAATCTGGCCTGGGTTGCCAAGCTTGAGAGCGCAGACCCTATGGACTCAAATCTCGACGCCATCAAGTACAAG
TGTTTGTGCCTCGCCTATGACTCGCAAGCCAGCAGCACCAGCTTGCAGATCTTCGACACCACTTGGGCCAACTGA
Transcript >OphauB2|7756
ATGGATGGCGAGTACTGCCAGATACACGTTGATGCTGCGCACGGCCCACCACGCATCCAAATCTTCTCCAAGAGT
GGCAAAGATAGCACTGAAGATAGAGTGGGATTGCACGACACCATTGCTCAATCGCTCAAACTTGGCTCTCTCGAT
TGTAAAGTTCGCAAACAGTGCATCCTCGAAGGGGAGCTTGTTGTCTACAGCGACAAGGAAAACAAGATTCTTCCT
TTTCACAAAATACGAAACCATGTATCGCGCCGAGGCTTATTCCTGAATGTAGAACAGGACTCTCCGCCACGGGAC
TGCGAACACCTTATGATTATATATTTCGACATCTTGCTCCTAGACGATGATTCTCTCTTGGCCACTCGCCACTCT
GAGAGGTTCAAAATTCTTGAAAGAATAGTTTCGCAACGTCAAGGGTGGTCCGAGTTGATTCAAAGACAAGTCATC
GACTTCCGAAGCCACTATGCATCTTCTGATTTGAGGAACGCTTTCGCTAGCATTATTGTGGCAAAGGATGAGGGA
CTGGTACTGAAGCCAGACGAGCCATACTTCAATCTCGAAGGGTTCAACAAGTCACTTGCAGGCTGCTGTATCAAA
CTGAAGAAGGAATACATTGGTAACTTTGGCGATGTTGGTGACTTTGCCGTTGTCGGGGCAGGCTTCAATGCTGCC
AAGGCCAAGTCATACAACATCCCAAATGTGAAATGGACCCACTTCTTCATCGGCTGCATCACGAACAAAGAAAAA
GCCAAGAACCCCCAGATCAATTCAGAGTTTACTGTCGTCAATGTCGTTGAGCTCAACAAGACGCAAATTGGAACA
CTTCTGAAGTTCGGAACGCCTCTACCACTTTCGGTCTCGGAAAACAAGGCAATCAAGGTGCAAGTTCCTCGAGGC
ATCGATACAAGCACACCAATGACTGTCATCTTTCAGAACCCGCTCGTCTTTGACCTTAGATGCTTCAGTTTCGAT
AAACCTGGAAACGTCGGGTTCTGGACACTGCGATTTCCAGTTGTCAGCAAAATTCACTTTGATCGCGACTACACA
GACACTGTTTCGTTTGATGAATTGCAGCAAATGGCCAAAGAGGCCACCACAATTCCTGAGGTGAAAGATAGTCAG
GAGAATCTGGCCTGGGTTGCCAAGCTTGAGAGCGCAGACCCTATGGACTCAAATCTCGACGCCATCAAGTACAAG
TGTTTGTGCCTCGCCTATGACTCGCAAGCCAGCAGCACCAGCTTGCAGATCTTCGACACCACTTGGGCCAACTGA
Gene >OphauB2|7756
ATGGATGGCGAGTACTGCCAGATACACGTTGATGCTGCGCACGGCCCACCACGCATCCAAATCTTCTCCAAGAGT
GGCAAAGATAGCACTGAAGATAGAGTGGGATTGCACGAGTAGGTCATACTGTCATCTCTCACCTACACGGCTTAC
TGATTCCATGACTAGCACCATTGCTCAATCGCTCAAACTTGGCTCTCTCGATTGTAAAGTTCGCAAACAGTGCAT
CCTCGAAGGGGAGCTTGTTGTCTACAGCGACAAGGTAGCATGGCATTCCGCTCTATTTGTCATCTGCTGACAGCC
CGTAGGAAAACAAGATTCTTCCTTTTCACAAAATACGAAACCATGTATCGCGCCGAGGCTTATTCCTGAATGTAG
AACAGGACTCTCCGTAAGTTGTGTCATTGTCTGTGTGATATTTCACTGACTCTGTTGACGGCACAAGGCCACGGG
ACTGCGAACACCTTATGATTATATATTTCGACATCTTGCTCCTAGACGATGATTCTCTCTTGGCCACTCGCCACT
CTGAGAGGTTCAAAATTCTTGAAAGAATAGTTTCGCAACGTCAAGGGTGGTCCGAGTTGATTCAAAGACAAGTCA
TCGACTTCCGAAGCCACTATGCATCTTCTGATTTGAGGAACGCTTTCGCTAGCATTATTGTGGCAAAGGATGAGG
GACTGGTACTGAAGCCAGACGAGCCATACTTCAATCTCGAAGGGTTCAACAAGTCACTTGCAGGCTGCTGTATCA
AACTGAAGAAGGAATACATTGGTAACTTTGGCGATGTTGGTGACTTTGCCGTTGTCGGGGCAGGCTTCAATGCTG
CCAAGGCCAAGTCATACAACATCCCAAATGTGAAATGGACCCACTTCTTCATCGGCTGCATCACGAACAAAGAAA
AAGCCAAGAACCCCCAGATCAATTCAGAGTTTACTGTCGTCAATGTCGTTGAGCTCAACAAGACGCAAATTGGAA
CACTTCTGAAGTTCGGAACGCCTCTACCACTTTCGGTCTCGGAAAACAAGGCAATCAAGGTGCAAGTTCCTCGAG
GCATCGATACAAGCACACCAATGACTGTCATCTTTCAGAACCCGCTCGTCTTTGACCTTAGATGCTTCAGTTTCG
ATAAACCTGGAAACGTCGGGTTCTGGACACTGCGATTTCCAGTTGTCAGCAAAATTCACTTTGATCGCGACTACA
CAGACACTGTTTCGTTTGATGAATTGCAGCAAATGGCCAAAGAGGCCACCACAATTCCTGAGGTGAAAGATAGTC
AGGAGAATCTGGCCTGGGTTGCCAAGCTTGAGAGCGCAGACCCTATGGACTCAAATCTCGACGCCATCAGTCAGA
TGACGACAACGGCTACGATTTCAACGCTGTCAGACTCGAATTCCACCCAGAGTACAAGTGTTTGTGCCTCGCCTA
TGACTCGCAAGCCAGCAGCACCAGCTTGCAGATCTTCGACACCACTTGGGCCAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail