Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7755
Gene name
LocationContig_88:27743..29016
Strand+
Gene length (bp)1273
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 1.7E-17 6 105
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 4.2E-13 166 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 1 333 2.0E-43
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 3 295 6.0E-16
sp|Q9LHN8|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1 OS=Arabidopsis thaliana GN=F6'H1 PE=1 SV=1 6 294 1.0E-15
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 6 284 2.0E-15
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 5 295 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 1 333 2.0E-43
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 3 295 6.0E-16
sp|Q9LHN8|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1 OS=Arabidopsis thaliana GN=F6'H1 PE=1 SV=1 6 294 1.0E-15
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 6 284 2.0E-15
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 5 295 3.0E-15
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 6 284 3.0E-15
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 6 284 3.0E-15
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 5 315 3.0E-14
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 17 293 4.0E-14
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 6 300 5.0E-14
sp|Q39103|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA3OX1 PE=1 SV=2 5 294 7.0E-14
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Solanum lycopersicum GN=ACO2 PE=2 SV=1 5 295 9.0E-14
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 6 295 2.0E-13
sp|D4N502|DIOX3_PAPSO Codeine O-demethylase OS=Papaver somniferum GN=CODM PE=1 SV=1 5 304 6.0E-13
sp|Q00985|ACCO1_MALDO 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Malus domestica PE=1 SV=1 4 295 6.0E-13
sp|Q43792|ACCO_TOBAC 1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1 5 346 6.0E-13
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 5 295 7.0E-13
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 17 293 8.0E-13
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 17 256 9.0E-13
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 6 295 9.0E-13
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase OS=Persea americana GN=ACO PE=2 SV=1 5 295 2.0E-12
sp|Q9ZT84|G3OX2_ARATH Gibberellin 3-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA3OX2 PE=1 SV=2 2 294 9.0E-12
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 6 315 1.0E-11
sp|D4N500|DIOX1_PAPSO Thebaine 6-O-demethylase OS=Papaver somniferum GN=T6ODM PE=1 SV=1 6 304 4.0E-11
sp|Q04644|ACCO1_CUCME 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1 4 295 4.0E-11
sp|Q39111|GAOX2_ARATH Gibberellin 20 oxidase 2 OS=Arabidopsis thaliana GN=GA20OX2 PE=2 SV=1 5 292 4.0E-11
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1 18 318 5.0E-11
sp|Q9XHM5|G2OX2_PEA Gibberellin 2-beta-dioxygenase 2 OS=Pisum sativum GN=GA2OX2 PE=2 SV=1 3 284 8.0E-11
sp|Q8XPV7|EFE_RALSO 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Ralstonia solanacearum (strain GMI1000) GN=efe PE=3 SV=1 45 293 2.0E-10
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 6 307 2.0E-10
sp|Q9ZWQ9|FLS_CITUN Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1 3 294 5.0E-10
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 2 293 7.0E-10
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 6 295 1.0E-09
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 3 335 1.0E-09
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 3 335 1.0E-09
sp|O64692|G2OX3_ARATH Gibberellin 2-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA2OX3 PE=2 SV=1 6 293 2.0E-09
sp|Q0WPW4|ACCO5_ARATH 1-aminocyclopropane-1-carboxylate oxidase 5 OS=Arabidopsis thaliana GN=At1g77330 PE=2 SV=1 6 292 3.0E-09
sp|Q39705|ACCO2_DORSP 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Doritaenopsis sp. GN=ACO2 PE=2 SV=1 1 295 3.0E-09
sp|P31528|ACCO_DIACA Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1 4 322 7.0E-09
sp|Q54243|IPNS_STRGR Isopenicillin N synthase OS=Streptomyces griseus GN=pcbC PE=3 SV=1 1 292 3.0E-08
sp|O04395|FLS_MATIN Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1 6 312 4.0E-08
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 5 255 7.0E-08
sp|P93771|GAOX1_ORYSJ Gibberellin 20 oxidase 1 OS=Oryza sativa subsp. japonica GN=20ox1 PE=2 SV=2 5 292 8.0E-08
sp|Q9FZ21|G2OX6_ARATH Gibberellin 2-beta-dioxygenase 6 OS=Arabidopsis thaliana GN=GA2OX6 PE=2 SV=1 5 294 1.0E-07
sp|Q4PT02|GAOX5_ARATH Gibberellin 20 oxidase 5 OS=Arabidopsis thaliana GN=GA20OX5 PE=2 SV=1 5 294 1.0E-07
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1 1 295 2.0E-07
sp|Q0JH50|GAOX2_ORYSJ Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1 126 295 3.0E-07
sp|P0C5H5|GAOX2_ORYSI Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1 126 295 3.0E-07
sp|Q9FFQ5|FLS3_ARATH Flavonol synthase 3 OS=Arabidopsis thaliana GN=FLS3 PE=2 SV=1 1 255 4.0E-07
sp|Q9ZQZ1|ACCO_DENCR 1-aminocyclopropane-1-carboxylate oxidase OS=Dendrobium crumenatum GN=ACO PE=2 SV=1 17 294 1.0E-06
sp|P31239|ACCO_PEA 1-aminocyclopropane-1-carboxylate oxidase OS=Pisum sativum GN=ACO PE=2 SV=1 187 292 5.0E-06
sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1 25 255 9.0E-06
sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase OS=Musa acuminata GN=MAO1B PE=3 SV=1 6 284 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7755
MSSANLPLIDLAGPEQDVARRLVDAAEQHGFLYIRNLGHDIPAGSIDEAFSISKKLFQTTLDEKQRYAIGKDNHG
WTGVRVETLDPEHQKIGDFKEAWNFAEFVNGKAQHPLPSVIAADEQRLSDFCNLCRKLCSKILYLLGLGLQIGDF
FSSAHFTTQDDSGTILRLLHYPRMSDTNSNDEIRAGAHSDYGSMTLLFRLRGQAGLEILKKDNTWAPVPVIPPGT
QDDPSPPILINFGDLLSYWTKGLFRSTLHRVTFPSSGSNGVQGESISQDRYSIAFFCHPIHSTRLEPVPSRRVQE
CTALDEESDINPYTKRRVMTAEEHVAMRLRATYTAINFGEDEPIKS*
Coding >OphauB2|7755
ATGTCTTCTGCCAATCTTCCCCTCATCGACCTTGCTGGTCCCGAGCAAGACGTCGCTCGCCGCCTCGTCGACGCC
GCCGAGCAGCATGGCTTCCTCTACATAAGAAACTTGGGCCATGACATCCCCGCCGGCTCCATTGACGAGGCCTTT
TCCATTTCCAAGAAACTTTTTCAAACAACTCTCGACGAGAAGCAGCGTTATGCCATTGGCAAAGACAATCACGGA
TGGACGGGCGTCCGCGTCGAGACTCTGGACCCTGAGCATCAAAAGATAGGGGATTTCAAAGAAGCCTGGAACTTT
GCCGAGTTTGTCAATGGCAAAGCCCAGCACCCTCTGCCCTCCGTGATAGCTGCCGATGAGCAGCGTCTCAGCGAC
TTCTGCAACTTGTGTCGCAAACTCTGTAGCAAGATTCTTTACCTGCTTGGCCTTGGCCTCCAAATTGGTGACTTC
TTCTCCTCTGCCCACTTTACTACTCAAGACGACTCTGGCACCATTCTCCGCCTCCTCCATTACCCGCGCATGTCT
GATACCAATAGTAATGACGAAATACGAGCTGGAGCCCATTCAGATTATGGCTCCATGACGCTCCTGTTTCGCCTC
CGGGGTCAGGCTGGCCTTGAAATTCTCAAAAAGGACAACACTTGGGCTCCGGTGCCTGTTATCCCTCCGGGAACA
CAAGACGATCCCAGCCCGCCCATCCTCATCAATTTCGGCGATCTTCTCTCCTACTGGACAAAGGGCCTTTTTCGC
AGCACTCTTCACCGCGTGACTTTTCCTTCTTCTGGCTCAAATGGTGTCCAAGGCGAGTCAATCTCCCAAGATCGC
TATTCCATAGCCTTCTTCTGCCACCCCATTCACTCTACTCGGCTCGAACCTGTTCCCAGTCGTCGGGTTCAAGAG
TGCACCGCCTTGGACGAGGAGTCCGATATCAACCCTTACACGAAACGAAGAGTCATGACAGCTGAGGAACACGTG
GCCATGAGACTCAGAGCCACCTACACGGCTATAAATTTCGGTGAAGACGAACCCATCAAGTCGTAA
Transcript >OphauB2|7755
ATGTCTTCTGCCAATCTTCCCCTCATCGACCTTGCTGGTCCCGAGCAAGACGTCGCTCGCCGCCTCGTCGACGCC
GCCGAGCAGCATGGCTTCCTCTACATAAGAAACTTGGGCCATGACATCCCCGCCGGCTCCATTGACGAGGCCTTT
TCCATTTCCAAGAAACTTTTTCAAACAACTCTCGACGAGAAGCAGCGTTATGCCATTGGCAAAGACAATCACGGA
TGGACGGGCGTCCGCGTCGAGACTCTGGACCCTGAGCATCAAAAGATAGGGGATTTCAAAGAAGCCTGGAACTTT
GCCGAGTTTGTCAATGGCAAAGCCCAGCACCCTCTGCCCTCCGTGATAGCTGCCGATGAGCAGCGTCTCAGCGAC
TTCTGCAACTTGTGTCGCAAACTCTGTAGCAAGATTCTTTACCTGCTTGGCCTTGGCCTCCAAATTGGTGACTTC
TTCTCCTCTGCCCACTTTACTACTCAAGACGACTCTGGCACCATTCTCCGCCTCCTCCATTACCCGCGCATGTCT
GATACCAATAGTAATGACGAAATACGAGCTGGAGCCCATTCAGATTATGGCTCCATGACGCTCCTGTTTCGCCTC
CGGGGTCAGGCTGGCCTTGAAATTCTCAAAAAGGACAACACTTGGGCTCCGGTGCCTGTTATCCCTCCGGGAACA
CAAGACGATCCCAGCCCGCCCATCCTCATCAATTTCGGCGATCTTCTCTCCTACTGGACAAAGGGCCTTTTTCGC
AGCACTCTTCACCGCGTGACTTTTCCTTCTTCTGGCTCAAATGGTGTCCAAGGCGAGTCAATCTCCCAAGATCGC
TATTCCATAGCCTTCTTCTGCCACCCCATTCACTCTACTCGGCTCGAACCTGTTCCCAGTCGTCGGGTTCAAGAG
TGCACCGCCTTGGACGAGGAGTCCGATATCAACCCTTACACGAAACGAAGAGTCATGACAGCTGAGGAACACGTG
GCCATGAGACTCAGAGCCACCTACACGGCTATAAATTTCGGTGAAGACGAACCCATCAAGTCGTAA
Gene >OphauB2|7755
ATGTCTTCTGCCAATCTTCCCCTCATCGACCTTGCTGGTCCCGAGCAAGACGTCGCTCGCCGCCTCGTCGACGCC
GCCGAGCAGCATGGCTTCCTCTACATAAGAAACTTGGGCCATGACATCCCCGCCGGCTCCATTGACGAGGCCTTT
TCCATTGTACTTTTCCCCTGTGCATCCCATGCATCCGTCTAGCCCACTGACCCCGCCAGTCCAAGAAACTTTTTC
AAACAACTCTCGACGAGAAGCAGCGTTATGCCATTGGCAAAGACAATCACGGATGGACGGGCGTCCGCGTCGAGA
CTCTGGACCCTGAGCATCAAAAGGCAAGCCGTTCCTCTGTCATTTCGCCATCAACTCGATGCTCACTCTCCACCT
TTTAGATAGGGGATTTCAAAGAGTAAGTCGCCCCACTGACCAAGCTCTTGCACCATGTCCTGGAAACTACTCTTA
CCCCTCTTGCTTTCCAGAGCCTGGAACTTTGCCGAGTTTGTCAATGGCAAAGCCCAGCACCCTCTGCCCTCCGTG
ATAGCTGCCGATGAGCAGCGTCTCAGCGACTTCTGCAACTTGTGTCGCAAACTCTGTAGCAAGATTCTTTACCTG
CTTGGCCTTGGCCTCCAAGTAAGCAGCCATCTCCCTCTCTTGACGTCTGCCTCCCGTCTGATGCTTGTAGATTGG
TGACTTCTTCTCCTCTGCCCACTTTACTACTCAAGACGACTCTGGCACCATTCTCCGCCTCCTCCATTACCCGCG
CATGTCTGATACCAATAGTAATGACGAAATACGAGCTGGAGCCCATTCAGATTATGGCTCCATGACGCTCCTGTT
TCGCCTCCGGGGTCAGGCTGGCCTTGAAATTCTCAAAAAGGACAACACTTGGGCTCCGGTGCCTGTTATCCCTCC
GGGAACACAAGACGATCCCAGCCCGCCCATCCTCATCAATTTCGGCGATCTTCTCTCCTACTGGACAAAGGGCCT
TTTTCGCAGCACTCTTCACCGCGTGACTTTTCCTTCTTCTGGCTCAAATGGTGTCCAAGGCGAGTCAATCTCCCA
AGATCGCTATTCCATAGCCTTCTTCTGCCACCCCATTCACTCTACTCGGCTCGAACCTGTTCCCAGTCGTCGGGT
TCAAGAGTGCACCGCCTTGGACGAGGAGTCCGATATCAACCCTTACACGAAACGAAGAGTCATGACAGCTGAGGA
ACACGTGGCCATGAGACTCAGAGCCACCTACACGGCTATAAATTTCGGTGAAGACGAACCCATCAAGTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail