Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7754
Gene name
LocationContig_88:24456..26898
Strand-
Gene length (bp)2442
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12246 MKT1_C Temperature dependent protein affecting M2 dsRNA replication 3.0E-70 484 726
PF12247 MKT1_N Temperature dependent protein affecting M2 dsRNA replication 9.2E-29 314 402

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40850|MKT1_YEAST Protein MKT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKT1 PE=1 SV=2 3 710 1.0E-24
sp|Q9UTN2|YII1_SCHPO Uncharacterized protein C139.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.01c PE=1 SV=2 19 675 7.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7754
MPFLVEDSWINAQAMTFDLYEIQDSAIAVDATYYLSYLLDNPPSHEPLLSALGGLTGIRAHIEANLDLWDKHRVT
PLFVFDGQSVIGQDEVSLARRRAANHRTDEAWNLYSQSQAEQAVATFGANPGAFCLKNLYPMLQRIIKQRHLQFL
VPPYSACAQLAYFELIDSDQCGGIMGPQELLLYPIRDSVIRSIDWEASTVTALCKRRVMRALGVGESMLVDSMLM
TGTSFLLPFPPLMDASMYPNPFTIMDAVNMLRTSDKSVANACASFNDILQSQDPEWLDRYRKARMAIHHFIYIAE
SGEVCVNDFERLTNDNHEYLGLQLPAELFHYLNTGLIGARNLSCITHGQILIQPTLEGGVSDEYKKLMTHDILPL
KEQALGLIIPRVHRGIGHKDITMRVWFDATFAYTINHRSLQPPPSSKVGTWDVKETDLRRFFPADFTGPIYLEVL
ALANSAFAETTKAKDKIIRGINSTEMVTSVAVWRFLHLRGYVNDNHELTRWGNALATTLLALKDANEDRPEVHGI
EEAALLAFELIRFGLFNSKQGGQVPGVPRKGSDEDRSSLTIISQCATLLRLRHQSYGYTGPLNKSLLAFRSLSSA
VREADRDLVEAIVASMFMYGQCARERNDYLEISHRLPFLEEPDIGLGIAVRTFFDDDEASDSKETRAARLAEFPT
TFVPFAESLTDDFHICVDFVVSVNQGVQTLDSKELAPSEKTHWAKAQEYLEARPF*
Coding >OphauB2|7754
ATGCCTTTCCTCGTGGAAGACTCGTGGATCAATGCCCAGGCTATGACGTTCGATCTCTATGAGATCCAGGATTCC
GCCATCGCCGTCGACGCCACGTACTACCTGAGCTACCTGCTCGACAACCCCCCTTCGCATGAGCCTCTACTCTCT
GCCCTGGGCGGCCTGACTGGCATCCGTGCCCACATCGAGGCCAATCTCGACCTTTGGGACAAGCACAGAGTGACA
CCTCTTTTCGTTTTCGACGGCCAGTCCGTCATTGGGCAGGACGAGGTTTCCTTGGCTCGTAGGCGAGCAGCCAAC
CATAGGACGGATGAGGCATGGAATCTCTACTCTCAGTCGCAAGCTGAGCAGGCTGTTGCAACATTTGGAGCAAAT
CCAGGTGCCTTTTGTCTCAAAAACCTGTACCCTATGCTACAGAGAATCATCAAGCAGCGCCACCTGCAGTTCCTC
GTTCCCCCATATAGTGCCTGTGCACAGCTGGCCTATTTTGAACTGATTGACTCGGACCAGTGTGGAGGCATCATG
GGCCCCCAAGAGCTTCTTCTCTACCCCATTAGGGACTCGGTGATTAGAAGCATTGACTGGGAGGCTAGTACGGTG
ACGGCTCTGTGTAAGAGGAGGGTGATGCGCGCGCTGGGAGTTGGCGAATCAATGCTTGTTGACTCGATGCTCATG
ACGGGCACTTCGTTTCTCCTTCCCTTCCCCCCGCTGATGGATGCCTCGATGTATCCAAACCCCTTTACCATTATG
GACGCGGTTAATATGCTGCGCACCTCGGACAAGTCTGTTGCCAATGCTTGCGCCTCATTCAACGACATACTGCAA
TCACAGGACCCAGAATGGCTCGACAGATATCGCAAAGCCCGAATGGCAATCCATCACTTTATATACATTGCCGAG
AGTGGCGAAGTTTGCGTCAACGACTTTGAGCGCCTGACAAACGACAATCACGAGTATCTGGGGCTCCAGCTGCCT
GCCGAGCTCTTCCATTACCTCAACACTGGCCTCATTGGCGCTCGGAATCTGAGTTGCATCACACACGGGCAAATC
CTGATCCAGCCAACGTTGGAGGGCGGCGTATCTGATGAGTATAAGAAACTCATGACGCACGACATTTTGCCCCTC
AAGGAGCAAGCACTTGGTCTCATCATCCCCAGGGTCCATCGCGGTATAGGACATAAGGACATCACAATGCGCGTT
TGGTTTGATGCCACCTTTGCTTACACAATCAATCATCGTTCCCTTCAGCCGCCCCCTTCGAGCAAAGTTGGGACT
TGGGACGTGAAGGAAACGGATTTGCGAAGGTTTTTTCCTGCTGATTTCACGGGACCCATTTACCTCGAGGTCTTG
GCTCTTGCCAATTCAGCTTTTGCTGAGACGACCAAGGCCAAGGATAAGATAATCAGGGGGATTAACAGTACGGAA
ATGGTGACATCAGTGGCAGTCTGGCGCTTTCTTCACCTCCGAGGCTACGTCAATGATAATCATGAGCTGACGAGA
TGGGGCAATGCTCTGGCCACAACACTACTTGCCCTCAAGGATGCCAATGAGGACCGGCCCGAAGTACATGGCATC
GAAGAAGCGGCTCTGCTTGCCTTTGAACTCATTAGATTTGGCTTGTTCAACAGCAAGCAAGGCGGCCAAGTGCCA
GGCGTGCCGCGCAAGGGCAGCGACGAGGACAGGTCGAGCTTGACCATAATTAGTCAATGTGCCACGCTTCTAAGA
CTGAGACACCAGTCGTATGGATATACAGGCCCGTTAAACAAGAGCCTATTGGCTTTTCGCTCACTTTCTTCGGCG
GTGCGGGAGGCTGATCGAGACTTGGTTGAGGCCATTGTGGCGTCAATGTTCATGTATGGGCAGTGTGCGAGAGAG
CGAAACGATTATTTGGAAATCAGTCATAGACTTCCTTTTCTCGAGGAACCAGACATTGGCCTGGGTATTGCTGTG
CGAACCTTTTTCGACGATGACGAAGCATCGGATAGCAAGGAGACGAGGGCGGCGAGGCTGGCAGAGTTTCCCACG
ACGTTTGTTCCTTTTGCCGAGTCACTGACGGACGACTTTCACATTTGTGTAGACTTTGTCGTGTCGGTGAACCAG
GGTGTACAGACTCTGGACAGCAAAGAATTGGCACCGTCGGAAAAGACACATTGGGCCAAGGCACAAGAGTATCTC
GAGGCACGACCTTTTTGA
Transcript >OphauB2|7754
ATGCCTTTCCTCGTGGAAGACTCGTGGATCAATGCCCAGGCTATGACGTTCGATCTCTATGAGATCCAGGATTCC
GCCATCGCCGTCGACGCCACGTACTACCTGAGCTACCTGCTCGACAACCCCCCTTCGCATGAGCCTCTACTCTCT
GCCCTGGGCGGCCTGACTGGCATCCGTGCCCACATCGAGGCCAATCTCGACCTTTGGGACAAGCACAGAGTGACA
CCTCTTTTCGTTTTCGACGGCCAGTCCGTCATTGGGCAGGACGAGGTTTCCTTGGCTCGTAGGCGAGCAGCCAAC
CATAGGACGGATGAGGCATGGAATCTCTACTCTCAGTCGCAAGCTGAGCAGGCTGTTGCAACATTTGGAGCAAAT
CCAGGTGCCTTTTGTCTCAAAAACCTGTACCCTATGCTACAGAGAATCATCAAGCAGCGCCACCTGCAGTTCCTC
GTTCCCCCATATAGTGCCTGTGCACAGCTGGCCTATTTTGAACTGATTGACTCGGACCAGTGTGGAGGCATCATG
GGCCCCCAAGAGCTTCTTCTCTACCCCATTAGGGACTCGGTGATTAGAAGCATTGACTGGGAGGCTAGTACGGTG
ACGGCTCTGTGTAAGAGGAGGGTGATGCGCGCGCTGGGAGTTGGCGAATCAATGCTTGTTGACTCGATGCTCATG
ACGGGCACTTCGTTTCTCCTTCCCTTCCCCCCGCTGATGGATGCCTCGATGTATCCAAACCCCTTTACCATTATG
GACGCGGTTAATATGCTGCGCACCTCGGACAAGTCTGTTGCCAATGCTTGCGCCTCATTCAACGACATACTGCAA
TCACAGGACCCAGAATGGCTCGACAGATATCGCAAAGCCCGAATGGCAATCCATCACTTTATATACATTGCCGAG
AGTGGCGAAGTTTGCGTCAACGACTTTGAGCGCCTGACAAACGACAATCACGAGTATCTGGGGCTCCAGCTGCCT
GCCGAGCTCTTCCATTACCTCAACACTGGCCTCATTGGCGCTCGGAATCTGAGTTGCATCACACACGGGCAAATC
CTGATCCAGCCAACGTTGGAGGGCGGCGTATCTGATGAGTATAAGAAACTCATGACGCACGACATTTTGCCCCTC
AAGGAGCAAGCACTTGGTCTCATCATCCCCAGGGTCCATCGCGGTATAGGACATAAGGACATCACAATGCGCGTT
TGGTTTGATGCCACCTTTGCTTACACAATCAATCATCGTTCCCTTCAGCCGCCCCCTTCGAGCAAAGTTGGGACT
TGGGACGTGAAGGAAACGGATTTGCGAAGGTTTTTTCCTGCTGATTTCACGGGACCCATTTACCTCGAGGTCTTG
GCTCTTGCCAATTCAGCTTTTGCTGAGACGACCAAGGCCAAGGATAAGATAATCAGGGGGATTAACAGTACGGAA
ATGGTGACATCAGTGGCAGTCTGGCGCTTTCTTCACCTCCGAGGCTACGTCAATGATAATCATGAGCTGACGAGA
TGGGGCAATGCTCTGGCCACAACACTACTTGCCCTCAAGGATGCCAATGAGGACCGGCCCGAAGTACATGGCATC
GAAGAAGCGGCTCTGCTTGCCTTTGAACTCATTAGATTTGGCTTGTTCAACAGCAAGCAAGGCGGCCAAGTGCCA
GGCGTGCCGCGCAAGGGCAGCGACGAGGACAGGTCGAGCTTGACCATAATTAGTCAATGTGCCACGCTTCTAAGA
CTGAGACACCAGTCGTATGGATATACAGGCCCGTTAAACAAGAGCCTATTGGCTTTTCGCTCACTTTCTTCGGCG
GTGCGGGAGGCTGATCGAGACTTGGTTGAGGCCATTGTGGCGTCAATGTTCATGTATGGGCAGTGTGCGAGAGAG
CGAAACGATTATTTGGAAATCAGTCATAGACTTCCTTTTCTCGAGGAACCAGACATTGGCCTGGGTATTGCTGTG
CGAACCTTTTTCGACGATGACGAAGCATCGGATAGCAAGGAGACGAGGGCGGCGAGGCTGGCAGAGTTTCCCACG
ACGTTTGTTCCTTTTGCCGAGTCACTGACGGACGACTTTCACATTTGTGTAGACTTTGTCGTGTCGGTGAACCAG
GGTGTACAGACTCTGGACAGCAAAGAATTGGCACCGTCGGAAAAGACACATTGGGCCAAGGCACAAGAGTATCTC
GAGGCACGACCTTTTTGA
Gene >OphauB2|7754
ATGCCTTGTGAGTTGGTTGCTTGCTGGAGGCGATTGGCGCAGCATGCTAATGCCGTGTCTCGACAGTCCTCGTGG
AAGACTCGTGGATCAATGCCCAGGCTATGTATGTCCTTTTTCCTCGCCTGAATGCCGCCACAGGCCATGGCCGCT
GACACAAGCACTGCTGGCAGGACGTTCGATCTCTATGAGATCCAGGATTCCGCCATCGCCGTCGACGCCACGTAC
TACCTGAGCTACCTGCTCGACAACCCCCCTTCGCATGAGCCTCTACTCTCTGCCCTGGGCGGCCTGACTGGCATC
CGTGCCCACATCGAGGCCAATCTCGACCTTTGGGACAAGCACAGAGTGACACCTCTTTTCGTTTTCGACGGCCAG
TCCGTCATTGGGCAGGACGAGGTTTCCTTGGCTCGTAGGCGAGCAGCCAACCATAGGACGGATGAGGCATGGAAT
CTCTACTCTCAGTCGCAAGCTGAGCAGGCTGTTGCAACATTTGGAGCAAATCCAGGTTGGTATGCTCGAGGCATA
GCACATGTGCTGTCGCTGACGCTTGCTGTCGCTCTCTAGGTGCCTTTTGTCTCAAAAACCTGTACCCTATGCTAC
AGAGAATCATCAAGCAGCGCCACCTGCAGTTCCTCGTTCCCCCATATAGTGCCTGTGCACAGCTGGCCTATTTTG
AACTGATTGACTCGGACCAGTGTGGAGGCATCATGGGCCCCCAAGAGCTTCTTCTCTACCCCATTAGGGACTCGG
TGATTAGAAGCATTGACTGGGAGGCTAGTACGGTGACGGCTCTGTGTAAGAGGAGGGTGATGCGCGCGCTGGGAG
TTGGCGAATCAATGCTTGTTGACTCGATGCTCATGACGGGCACTTCGTTTCTCCTTCCCTTCCCCCCGCTGATGG
ATGCCTCGATGTATCCAAACCCCTTTACCATTATGGACGCGGTTAATATGCTGCGCACCTCGGACAAGTCTGTTG
CCAATGCTTGCGCCTCATTCAACGACATACTGCAATCACAGGACCCAGAATGGCTCGACAGATATCGCAAAGCCC
GAATGGCAATCCATCACTTTATATACATTGCCGAGAGTGGCGAAGTTTGCGTCAACGACTTTGAGCGCCTGACAA
ACGACAATCACGAGTATCTGGGGCTCCAGCTGCCTGCCGAGCTCTTCCATTACCTCAACACTGGCCTCATTGGCG
CTCGGAATCTGAGTTGCATCACACACGGGCAAATCCTGATCCAGCCAACGTTGGAGGGCGGCGTATCTGATGAGT
ATAAGAAACTCATGACGCACGACATTTTGCCCCTCAAGGAGCAAGCACTTGGTCTCATCATCCCCAGGGTCCATC
GCGGTATAGGACATAAGGACATCACAATGCGCGTTTGGTTTGATGCCACCTTTGCTTACACAATCAATCATCGTT
CCCTTCAGCCGCCCCCTTCGAGCAAAGTTGGGACTTGGGACGTGAAGGAAACGGATTTGCGAAGGTTTTTTCCTG
CTGATTTCACGGGACCCATTTACCTCGAGGTCTTGGCTCTTGCCAATTCAGCTTTTGCTGAGACGACCAAGGCCA
AGGATAAGATAATCAGGGGGATTAACAGTACGGAAATGGTGACATCAGTGGCAGTCTGGCGCTTTCTTCACCTCC
GAGGCTACGTCAATGATAATCATGAGCTGACGAGATGGGGCAATGCTCTGGCCACAACACTACTTGCCCTCAAGG
ATGCCAATGAGGACCGGCCCGAAGTACATGGCATCGAAGAAGCGGCTCTGCTTGCCTTTGAACTCATTAGATTTG
GCTTGTTCAACAGCAAGCAAGGCGGCCAAGTGCCAGGCGTGCCGCGCAAGGGCAGCGACGAGGACAGGTCGAGCT
TGACCATAATTAGTCAATGTGCCACGCTTCTAAGACTGAGACACCAGTCGTATGGATATACAGGCCCGTTAAACA
AGAGCCTATTGGCTTTTCGCTCACTTTCTTCGGCGGTGCGGGAGGCTGATCGAGACTTGGTTGAGGCCATTGTGG
CGTCAATGTTCATGTATGGGCAGTGTGCGAGAGAGCGAAACGATTATTTGGAAATCAGTCATAGGTGAGGCCAGG
CCTGTCTTGTGGTGGCACGCGGCTTTGCCATTTGACTAACAAGGTGGACGCAGACTTCCTTTTCTCGAGGAACCA
GACATTGGCCTGGGTATTGCTGTGCGAACCTTTTTCGACGATGACGAAGCATCGGATAGCAAGGAGACGAGGGCG
GCGAGGCTGGCAGAGTTTCCCACGACGTTTGTTCCTTTTGCCGAGTCACTGACGGACGACTTTCACATTTGTGTA
GACTTTGTCGTGTCGGTGAACCAGGGTGTACAGACTCTGGACAGCAAAGAATTGGCACCGTCGGAAAAGACACAT
TGGGCCAAGGCACAAGAGTATCTCGAGGCACGACCTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail