Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7752
Gene name
LocationContig_88:16227..20594
Strand+
Gene length (bp)4367
Transcript length (bp)4086
Coding sequence length (bp)4086
Protein length (aa) 1362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 3.8E-77 744 1077
PF17877 Dis3l2_C_term DIS3-like exonuclease 2 C terminal 1.5E-25 1129 1209
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 9.1E-26 637 712

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 415 1359 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 415 1360 0.0E+00
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 413 1181 2.0E-143
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 415 1184 4.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 402 1182 5.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 415 1359 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 415 1360 0.0E+00
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 413 1181 2.0E-143
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 415 1184 4.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 402 1182 5.0E-104
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 402 1182 3.0E-96
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 418 1182 4.0E-94
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 416 1209 5.0E-90
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 551 1158 1.0E-82
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 364 1184 2.0E-66
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 364 1184 2.0E-65
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 639 1159 9.0E-65
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 641 1155 3.0E-64
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 641 1155 3.0E-64
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 641 1155 7.0E-64
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 641 1155 8.0E-64
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 641 1155 2.0E-63
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 628 1159 4.0E-61
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 419 1163 1.0E-60
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 639 1158 3.0E-60
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 404 1158 4.0E-60
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 639 1187 2.0E-59
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 637 1163 3.0E-59
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 637 1155 2.0E-58
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 637 1155 1.0E-57
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 737 1082 3.0E-45
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 690 1216 2.0E-41
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 673 1163 5.0E-40
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 690 1189 1.0E-39
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 738 1080 2.0E-38
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 690 1164 1.0E-37
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 671 1120 3.0E-33
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 687 1170 1.0E-27
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 738 1072 2.0E-27
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 738 1163 6.0E-27
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 660 1076 4.0E-25
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 737 1072 1.0E-24
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 686 1078 2.0E-24
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 744 1163 4.0E-24
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 744 1163 1.0E-23
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 744 1178 1.0E-21
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 736 1072 2.0E-20
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 737 1163 2.0E-20
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 778 1177 4.0E-20
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 737 1163 7.0E-19
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 727 1076 1.0E-16
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 727 1076 4.0E-16
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 727 1076 8.0E-16
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 727 1074 1.0E-15
sp|D3V184|RNB_XENBS Exoribonuclease 2 OS=Xenorhabdus bovienii (strain SS-2004) GN=rnb PE=3 SV=1 737 1078 3.0E-14
sp|B4EW02|RNB_PROMH Exoribonuclease 2 OS=Proteus mirabilis (strain HI4320) GN=rnb PE=3 SV=1 744 1079 2.0E-13
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 742 1084 4.0E-13
sp|B5XS03|RNB_KLEP3 Exoribonuclease 2 OS=Klebsiella pneumoniae (strain 342) GN=rnb PE=3 SV=1 743 1076 5.0E-13
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 743 1076 2.0E-12
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 641 907 5.0E-12
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 727 1074 7.0E-12
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 727 1074 7.0E-12
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 727 1074 1.0E-11
sp|Q7N4F5|RNB_PHOLL Exoribonuclease 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnb PE=3 SV=1 744 1082 2.0E-11
sp|A6T7Z4|RNB_KLEP7 Exoribonuclease 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnb PE=3 SV=1 743 1076 2.0E-11
sp|A4WAX5|RNB_ENT38 Exoribonuclease 2 OS=Enterobacter sp. (strain 638) GN=rnb PE=3 SV=1 744 1076 2.0E-11
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 663 1076 3.0E-11
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 744 871 7.0E-10
sp|Q9ZJX9|RNR_HELPJ Ribonuclease R OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnr PE=3 SV=1 779 1076 2.0E-07
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 744 877 5.0E-07
sp|P39112|DSS1_YEAST Exoribonuclease II, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSS1 PE=1 SV=2 742 1096 8.0E-07
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 408 493 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7752
MEQQQQQQNKSQQQQSGHGQPSGNVPGPAGRRLHIAHRRSPSELTPLMSMFAANPGIEQLAIQQQIELLQQQQQQ
LQATHQQYVNLGMLPPGQPMAHNGAFNPLQPMANMPQNAFQFPNQIPQQNMAMAPPTQPLSHRRNQSALPNMGMG
MGGPPPAPSSGASGSSFGNFEAPGSHGRENTGGRGGRGGGSASSHQRRHSLALADAKKAAEIAQQKRTTTGFQFP
GPAASSGKIEDENSRMTATHSNLDASVAHGSTRGRGGHGRSQSMATNGRGGTRIAPDAGGDFHRRGGGGGHARTG
SRSFEGNWRTQNQNQDQSGNLNQAFQPGHRPRGSVSQSVSSIGAFQYNPSQPQLMQIPGQIVMPQMFGQQLNAMQ
MNQLQALQAAQMNGQQFQGLQNSQHAGPMGSQQQQQQQQRKTLFTPYLPQASLPALLGDGQLVSGILRVNKKNRS
DAYVTTQDGLLDADIFICGSKDRNRALEGDLVAVELLDVDEVWSQKREKEEKKKRKDITDTRSGSTNQGNHNSSQ
NDDGNTAEGGIRRRGSLRQRPTQKKNDDVEVEGQSLLLVEEEEINDEQKPLYAGHIVAVIERVAGQMFSGTLGLL
RPSSQATKEKQEAERAARDGGNSRHNDTRQPEKPKIVWFKPTDKRVPLIAIPTEQAPRDFVDKHQDYADRIFVAC
IKRWPITSLHPFGTLVEQLGRMGDLKVETDALLRDNNFSSDEFSDAVLRSVGFQDWTLASEDEASIESRRDFREE
QVFTIDFNGSVELGNAVHIKTGADGKIEVGIHVPDVAHFVKPNSLVDREAKKRGTSVQLLNRFCALLPPKLSGEL
CSLQPQEDRLTVSVVFNVNAHTGAVAEGDSWVGRSIVKSAGKLSLQDIDRALGDPTTFSSGAATSKTIQILQGVA
QKFREARLGAGGEPIAPLRLFHQLDDENNPVQENIFDSTPALELVEELMQKTNAYVAQRLAEGLPEKALLRRQAS
PNPRRLQTFVERMTALGYDVDASGSGALQNSLFKIDDAELRKGMETLVLKSMQRAKYFIAGKTAKPLWPHYCLNL
PLYTHFTSPTRRYADILVHRQLEAVLSEGKIDFTDDMESLVKTVESCNTKKDSAQNAQEQSIHIESCRTMDKKRQ
EVNGDLIAEGVVLCVYESAFDVLIPEWGFEKRVHCDQLPLKKAEFRKEKRVLELYWEKGVPSSAYVPEDERPKAA
SSQRISNAMAAARQAEEAEKARKEREEAARKQTETGTMSTDDVEALFDDEDDNTSDVTEAMAGASLAERPTQSVP
GSPARTSSNAGTLHRTRSDSKVPISETVEGRLTNKERYLDLFKLREEGGDYIQDVTEMTRLPIILKTDLSKSPPC
LTIRSLNPYAL*
Coding >OphauB2|7752
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCTCAACAGCAGCAATCGGGACATGGCCAGCCCTCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGGCTGCACATCGCCCATCGACGGAGCCCCTCGGAGCTGACACCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAATTGAACAGTTGGCAATTCAGCAGCAGATCGAGCTCTTACAGCAGCAGCAGCAGCAG
CTCCAGGCGACGCATCAGCAATATGTCAACCTGGGTATGCTGCCCCCGGGTCAGCCCATGGCCCACAACGGCGCT
TTCAATCCTTTGCAGCCCATGGCCAATATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCCGCAACAGAAC
ATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCGGCTCTACCCAATATGGGCATGGGC
ATGGGCGGCCCACCCCCTGCACCTTCTTCAGGCGCTTCGGGCTCCAGTTTTGGCAACTTTGAGGCTCCCGGCTCC
CATGGCAGAGAAAACACTGGCGGCCGAGGCGGCCGGGGCGGAGGCTCCGCCTCGAGCCATCAGCGAAGACATTCT
CTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATTTCAATTCCCC
GGTCCTGCCGCCTCGTCTGGCAAAATCGAGGACGAAAACAGCAGAATGACCGCCACTCATTCCAACCTTGACGCC
TCTGTCGCCCACGGCTCAACCCGTGGCCGTGGAGGACATGGCCGTAGTCAAAGTATGGCTACCAATGGTCGCGGA
GGCACTCGCATCGCACCCGATGCCGGCGGTGACTTTCATCGGCGCGGCGGCGGCGGCGGTCATGCCCGGACTGGA
TCTCGGAGCTTTGAGGGCAACTGGCGCACTCAAAACCAGAATCAAGATCAGTCTGGCAATTTGAACCAGGCTTTT
CAGCCCGGTCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTTTCAATATAATCCAAGC
CAGCCTCAACTCATGCAAATCCCGGGCCAGATTGTGATGCCACAAATGTTTGGCCAGCAGCTCAACGCTATGCAG
ATGAATCAGTTGCAGGCTCTCCAAGCGGCTCAAATGAATGGGCAGCAGTTTCAAGGTCTGCAGAACTCTCAGCAT
GCGGGACCAATGGGGAGTCAGCAGCAGCAACAACAACAGCAGCGCAAGACGCTTTTCACCCCATATTTGCCCCAG
GCCTCCCTCCCTGCCCTCTTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAATAAGAAGAATCGCAGC
GACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCTGACATCTTTATTTGCGGTAGCAAGGACCGCAACCGA
GCCCTCGAGGGCGACTTGGTGGCTGTCGAGCTTCTTGATGTTGATGAGGTTTGGTCTCAGAAGCGAGAGAAGGAG
GAAAAGAAGAAGCGAAAGGACATCACCGACACTCGTTCTGGCTCGACAAATCAAGGCAATCACAATTCTAGTCAG
AATGACGATGGAAACACTGCTGAGGGTGGCATTCGCCGCCGAGGTAGTCTGCGTCAGCGTCCAACTCAAAAGAAG
AACGATGACGTTGAAGTTGAGGGCCAGAGTCTTCTTTTGGTTGAAGAAGAAGAAATCAATGATGAGCAGAAGCCT
CTGTACGCCGGCCACATTGTCGCGGTCATTGAGCGCGTGGCTGGACAAATGTTTTCGGGAACTCTAGGCCTGTTA
CGGCCTAGCAGTCAGGCTACCAAGGAGAAACAGGAAGCTGAAAGAGCCGCTAGGGATGGTGGCAACAGCCGTCAC
AATGATACTCGGCAGCCAGAAAAGCCAAAGATTGTCTGGTTCAAGCCAACGGACAAGCGAGTCCCCTTGATTGCT
ATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGATTACGCTGATCGGATTTTTGTGGCGTGC
ATCAAGCGATGGCCAATCACGTCTCTACATCCCTTTGGCACTTTGGTGGAACAGCTGGGCCGCATGGGTGACCTT
AAGGTGGAAACCGATGCACTGCTTCGAGACAACAACTTTTCGTCTGATGAATTTTCGGATGCTGTGCTTCGCAGC
GTTGGCTTCCAGGACTGGACCTTGGCGAGTGAAGACGAAGCGTCGATAGAAAGTCGCCGTGATTTCCGCGAGGAA
CAAGTCTTCACCATCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCACATCAAGACTGGCGCTGACGGC
AAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCTAGTGGATAGAGAGGCC
AAGAAGCGTGGCACATCGGTGCAGCTCCTCAATCGGTTCTGTGCGCTGCTTCCGCCCAAGCTGTCGGGTGAGCTT
TGCTCTCTGCAGCCTCAAGAGGATCGCTTGACGGTGAGCGTTGTGTTCAATGTGAATGCGCACACTGGCGCGGTT
GCCGAGGGTGACAGCTGGGTTGGACGCAGCATCGTCAAGAGCGCAGGCAAGCTGTCACTCCAAGACATTGACAGG
GCGCTTGGGGATCCAACAACCTTTTCGAGCGGAGCGGCGACGAGCAAGACTATTCAGATTCTGCAAGGCGTGGCA
CAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGAGAACCGATTGCGCCGCTACGTCTGTTTCACCAGCTTGAC
GACGAGAACAACCCGGTACAGGAAAATATATTTGACTCGACACCGGCGCTGGAGCTGGTTGAGGAGCTCATGCAA
AAGACAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCTCTTCTTCGCCGCCAGGCCTCT
CCCAATCCGCGTCGCCTGCAGACTTTTGTCGAGCGCATGACGGCCCTTGGCTACGATGTGGATGCGTCGGGAAGC
GGAGCTCTTCAGAACAGCTTGTTCAAGATTGACGACGCTGAGCTTCGCAAGGGCATGGAGACATTGGTGCTCAAG
TCGATGCAGCGCGCCAAGTACTTTATCGCAGGCAAAACTGCCAAGCCATTGTGGCCGCACTACTGCCTCAATCTG
CCACTTTATACACATTTTACGAGTCCGACGCGTCGCTACGCGGATATTTTGGTGCACCGACAACTCGAGGCTGTT
TTATCAGAGGGCAAGATTGACTTTACAGATGACATGGAAAGCTTGGTCAAGACGGTTGAGTCGTGCAATACCAAG
AAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATTGAGTCGTGCCGCACCATGGACAAGAAGCGACAA
GAGGTCAACGGAGACTTGATAGCCGAAGGTGTCGTGCTGTGCGTCTACGAGTCAGCCTTTGATGTGCTGATTCCA
GAGTGGGGGTTTGAGAAGCGAGTGCACTGCGACCAGCTGCCACTCAAGAAGGCTGAATTTAGAAAGGAGAAGCGA
GTGCTCGAGTTGTACTGGGAAAAGGGAGTGCCGAGCTCGGCCTACGTTCCCGAGGACGAGCGGCCAAAGGCAGCA
TCATCACAGCGGATTTCGAATGCCATGGCAGCGGCACGGCAGGCAGAAGAGGCGGAAAAGGCCAGAAAGGAGCGA
GAAGAGGCAGCCCGCAAGCAGACTGAGACGGGCACCATGTCGACGGACGATGTCGAGGCGCTCTTTGACGATGAG
GACGACAATACCTCGGACGTGACTGAGGCCATGGCTGGAGCGTCGCTGGCGGAGCGGCCGACGCAGAGCGTCCCC
GGATCGCCGGCGCGCACATCGTCGAATGCCGGCACGCTACATCGAACCCGGTCCGACTCCAAGGTGCCCATCTCG
GAGACGGTTGAGGGACGCCTCACCAACAAGGAGAGATACCTTGATCTGTTCAAGTTGCGGGAAGAGGGCGGCGAC
TACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATTATTTTGAAGACGGACCTCAGCAAGAGCCCGCCATGC
CTGACGATTCGCTCTCTGAATCCGTATGCCCTGTAA
Transcript >OphauB2|7752
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCTCAACAGCAGCAATCGGGACATGGCCAGCCCTCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGGCTGCACATCGCCCATCGACGGAGCCCCTCGGAGCTGACACCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAATTGAACAGTTGGCAATTCAGCAGCAGATCGAGCTCTTACAGCAGCAGCAGCAGCAG
CTCCAGGCGACGCATCAGCAATATGTCAACCTGGGTATGCTGCCCCCGGGTCAGCCCATGGCCCACAACGGCGCT
TTCAATCCTTTGCAGCCCATGGCCAATATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCCGCAACAGAAC
ATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCGGCTCTACCCAATATGGGCATGGGC
ATGGGCGGCCCACCCCCTGCACCTTCTTCAGGCGCTTCGGGCTCCAGTTTTGGCAACTTTGAGGCTCCCGGCTCC
CATGGCAGAGAAAACACTGGCGGCCGAGGCGGCCGGGGCGGAGGCTCCGCCTCGAGCCATCAGCGAAGACATTCT
CTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATTTCAATTCCCC
GGTCCTGCCGCCTCGTCTGGCAAAATCGAGGACGAAAACAGCAGAATGACCGCCACTCATTCCAACCTTGACGCC
TCTGTCGCCCACGGCTCAACCCGTGGCCGTGGAGGACATGGCCGTAGTCAAAGTATGGCTACCAATGGTCGCGGA
GGCACTCGCATCGCACCCGATGCCGGCGGTGACTTTCATCGGCGCGGCGGCGGCGGCGGTCATGCCCGGACTGGA
TCTCGGAGCTTTGAGGGCAACTGGCGCACTCAAAACCAGAATCAAGATCAGTCTGGCAATTTGAACCAGGCTTTT
CAGCCCGGTCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTTTCAATATAATCCAAGC
CAGCCTCAACTCATGCAAATCCCGGGCCAGATTGTGATGCCACAAATGTTTGGCCAGCAGCTCAACGCTATGCAG
ATGAATCAGTTGCAGGCTCTCCAAGCGGCTCAAATGAATGGGCAGCAGTTTCAAGGTCTGCAGAACTCTCAGCAT
GCGGGACCAATGGGGAGTCAGCAGCAGCAACAACAACAGCAGCGCAAGACGCTTTTCACCCCATATTTGCCCCAG
GCCTCCCTCCCTGCCCTCTTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAATAAGAAGAATCGCAGC
GACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCTGACATCTTTATTTGCGGTAGCAAGGACCGCAACCGA
GCCCTCGAGGGCGACTTGGTGGCTGTCGAGCTTCTTGATGTTGATGAGGTTTGGTCTCAGAAGCGAGAGAAGGAG
GAAAAGAAGAAGCGAAAGGACATCACCGACACTCGTTCTGGCTCGACAAATCAAGGCAATCACAATTCTAGTCAG
AATGACGATGGAAACACTGCTGAGGGTGGCATTCGCCGCCGAGGTAGTCTGCGTCAGCGTCCAACTCAAAAGAAG
AACGATGACGTTGAAGTTGAGGGCCAGAGTCTTCTTTTGGTTGAAGAAGAAGAAATCAATGATGAGCAGAAGCCT
CTGTACGCCGGCCACATTGTCGCGGTCATTGAGCGCGTGGCTGGACAAATGTTTTCGGGAACTCTAGGCCTGTTA
CGGCCTAGCAGTCAGGCTACCAAGGAGAAACAGGAAGCTGAAAGAGCCGCTAGGGATGGTGGCAACAGCCGTCAC
AATGATACTCGGCAGCCAGAAAAGCCAAAGATTGTCTGGTTCAAGCCAACGGACAAGCGAGTCCCCTTGATTGCT
ATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGATTACGCTGATCGGATTTTTGTGGCGTGC
ATCAAGCGATGGCCAATCACGTCTCTACATCCCTTTGGCACTTTGGTGGAACAGCTGGGCCGCATGGGTGACCTT
AAGGTGGAAACCGATGCACTGCTTCGAGACAACAACTTTTCGTCTGATGAATTTTCGGATGCTGTGCTTCGCAGC
GTTGGCTTCCAGGACTGGACCTTGGCGAGTGAAGACGAAGCGTCGATAGAAAGTCGCCGTGATTTCCGCGAGGAA
CAAGTCTTCACCATCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCACATCAAGACTGGCGCTGACGGC
AAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCTAGTGGATAGAGAGGCC
AAGAAGCGTGGCACATCGGTGCAGCTCCTCAATCGGTTCTGTGCGCTGCTTCCGCCCAAGCTGTCGGGTGAGCTT
TGCTCTCTGCAGCCTCAAGAGGATCGCTTGACGGTGAGCGTTGTGTTCAATGTGAATGCGCACACTGGCGCGGTT
GCCGAGGGTGACAGCTGGGTTGGACGCAGCATCGTCAAGAGCGCAGGCAAGCTGTCACTCCAAGACATTGACAGG
GCGCTTGGGGATCCAACAACCTTTTCGAGCGGAGCGGCGACGAGCAAGACTATTCAGATTCTGCAAGGCGTGGCA
CAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGAGAACCGATTGCGCCGCTACGTCTGTTTCACCAGCTTGAC
GACGAGAACAACCCGGTACAGGAAAATATATTTGACTCGACACCGGCGCTGGAGCTGGTTGAGGAGCTCATGCAA
AAGACAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCTCTTCTTCGCCGCCAGGCCTCT
CCCAATCCGCGTCGCCTGCAGACTTTTGTCGAGCGCATGACGGCCCTTGGCTACGATGTGGATGCGTCGGGAAGC
GGAGCTCTTCAGAACAGCTTGTTCAAGATTGACGACGCTGAGCTTCGCAAGGGCATGGAGACATTGGTGCTCAAG
TCGATGCAGCGCGCCAAGTACTTTATCGCAGGCAAAACTGCCAAGCCATTGTGGCCGCACTACTGCCTCAATCTG
CCACTTTATACACATTTTACGAGTCCGACGCGTCGCTACGCGGATATTTTGGTGCACCGACAACTCGAGGCTGTT
TTATCAGAGGGCAAGATTGACTTTACAGATGACATGGAAAGCTTGGTCAAGACGGTTGAGTCGTGCAATACCAAG
AAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATTGAGTCGTGCCGCACCATGGACAAGAAGCGACAA
GAGGTCAACGGAGACTTGATAGCCGAAGGTGTCGTGCTGTGCGTCTACGAGTCAGCCTTTGATGTGCTGATTCCA
GAGTGGGGGTTTGAGAAGCGAGTGCACTGCGACCAGCTGCCACTCAAGAAGGCTGAATTTAGAAAGGAGAAGCGA
GTGCTCGAGTTGTACTGGGAAAAGGGAGTGCCGAGCTCGGCCTACGTTCCCGAGGACGAGCGGCCAAAGGCAGCA
TCATCACAGCGGATTTCGAATGCCATGGCAGCGGCACGGCAGGCAGAAGAGGCGGAAAAGGCCAGAAAGGAGCGA
GAAGAGGCAGCCCGCAAGCAGACTGAGACGGGCACCATGTCGACGGACGATGTCGAGGCGCTCTTTGACGATGAG
GACGACAATACCTCGGACGTGACTGAGGCCATGGCTGGAGCGTCGCTGGCGGAGCGGCCGACGCAGAGCGTCCCC
GGATCGCCGGCGCGCACATCGTCGAATGCCGGCACGCTACATCGAACCCGGTCCGACTCCAAGGTGCCCATCTCG
GAGACGGTTGAGGGACGCCTCACCAACAAGGAGAGATACCTTGATCTGTTCAAGTTGCGGGAAGAGGGCGGCGAC
TACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATTATTTTGAAGACGGACCTCAGCAAGAGCCCGCCATGC
CTGACGATTCGCTCTCTGAATCCGTATGCCCTGTAA
Gene >OphauB2|7752
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCTCAACAGCAGCAATCGGGACATGGCCAGCCCTCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGGCTGCACATCGCCCATCGACGGAGCCCCTCGGAGCTGACACCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAAGTGAGTTTTTTATTGCCACGATTCTCCCCCTTCACTCCAGCCTTTGGACCAGACTG
GCATCCTGCCCCACGTTTTATTTTTCAGCTTCCTCATCACCTGCCTGATTGTCTTTTCCCACGCCCCTCCCGCTG
ATGATGCTGCCGCTGACGTCTTGTCCTTGTCGCAGTTGAACAGTTGGCAATTCAGCAGCAGATCGAGCTCTTACA
GCAGCAGCAGCAGCAGCTCCAGGCGACGCATCAGCAATATGTCAACCTGGGTATGCTGCCCCCGGGTCAGCCCAT
GGCCCACAACGGCGCTTTCAATCCTTTGCAGCCCATGGCCAATATGCCTCAGAATGCTTTTCAATTCCCAAACCA
GATTCCGCAACAGAACATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCGGCTCTACC
CAATATGGGCATGGGCATGGGCGGCCCACCCCCTGCACCTTCTTCAGGCGCTTCGGGCTCCAGTTTTGGCAACTT
TGAGGCTCCCGGCTCCCATGGCAGAGAAAACACTGGCGGCCGAGGCGGCCGGGGCGGAGGCTCCGCCTCGAGCCA
TCAGCGAAGACATTCTCTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTAC
CGGATTTCAATTCCCCGGTCCTGCCGCCTCGTCTGGCAAAATCGAGGACGAAAACAGCAGAATGACCGCCACTCA
TTCCAACCTTGACGCCTCTGTCGCCCACGGCTCAACCCGTGGCCGTGGAGGACATGGCCGTAGTCAAAGTATGGC
TACCAATGGTCGCGGAGGCACTCGCATCGCACCCGATGCCGGCGGTGACTTTCATCGGCGCGGCGGCGGCGGCGG
TCATGCCCGGACTGGATCTCGGAGCTTTGAGGGCAACTGGCGCACTCAAAACCAGAATCAAGATCAGTCTGGCAA
TTTGAACCAGGCTTTTCAGCCCGGTCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTT
TCAATATAATCCAAGCCAGCCTCAACTCATGCAAATCCCGGGCCAGATTGTGATGCCACAAATGTTTGGCCAGCA
GCTCAACGCTATGCAGATGAATCAGTTGCAGGCTCTCCAAGCGGCTCAAATGAATGGGCAGCAGTTTCAAGGTCT
GCAGAACTCTCAGCATGCGGGACCAATGGGGAGTCAGCAGCAGCAACAACAACAGCAGCGCAAGACGCTTTTCAC
CCCATATTTGCCCCAGGCCTCCCTCCCTGCCCTCTTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAA
TAAGAAGAATCGCAGCGACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCTGACATCTTTATTTGCGGTAG
CAAGGACCGCAACCGAGCCCTCGAGGGCGACTTGGTGGCTGTCGAGCTTCTTGATGTTGATGAGGTTTGGTCTCA
GAAGCGAGAGAAGGAGGAAAAGAAGAAGCGAAAGGACATCACCGACACTCGTTCTGGCTCGACAAATCAAGGCAA
TCACAATTCTAGTCAGAATGACGATGGAAACACTGCTGAGGGTGGCATTCGCCGCCGAGGTAGTCTGCGTCAGCG
TCCAACTCAAAAGAAGAACGATGACGTTGAAGTTGAGGGCCAGAGTCTTCTTTTGGTTGAAGAAGAAGAAATCAA
TGATGAGCAGAAGCCTCTGTACGCCGGCCACATTGTCGCGGTCATTGAGCGCGTGGCTGGACAAATGTTTTCGGG
AACTCTAGGCCTGTTACGGCCTAGCAGTCAGGCTACCAAGGAGAAACAGGAAGCTGAAAGAGCCGCTAGGGATGG
TGGCAACAGCCGTCACAATGATACTCGGCAGCCAGAAAAGCCAAAGATTGTCTGGTTCAAGCCAACGGACAAGCG
AGTCCCCTTGATTGCTATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGATTACGCTGATCG
GATTTTTGTGGCGTGCATCAAGCGATGGCCAATCACGTCTCTACATCCCTTTGGCACTTTGGTGGAACAGCTGGG
CCGCATGGGTGACCTTAAGGTGGAAACCGATGCACTGCTTCGAGACAACAACTTTTCGTCTGATGAATTTTCGGA
TGCTGTGCTTCGCAGCGTTGGCTTCCAGGACTGGACCTTGGCGAGTGAAGACGAAGCGTCGATAGAAAGTCGCCG
TGATTTCCGCGAGGAACAAGTCTTCACCATCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCACATCAA
GACTGGCGCTGACGGCAAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCT
AGTGGATAGAGAGGCCAAGAAGCGTGGCACATCGGTGCAGCTCCTCAATCGGTTCTGTGCGCTGCTTCCGCCCAA
GCTGTCGGGTGAGCTTTGCTCTCTGCAGCCTCAAGAGGATCGCTTGACGGTGAGCGTTGTGTTCAATGTGAATGC
GCACACTGGCGCGGTTGCCGAGGGTGACAGCTGGGTTGGACGCAGCATCGTCAAGAGCGCAGGCAAGCTGTCACT
CCAAGACATTGACAGGGCGCTTGGGGATCCAACAACCTTTTCGAGCGGAGCGGCGACGAGCAAGACTATTCAGAT
TCTGCAAGGCGTGGCACAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGAGAACCGATTGCGCCGCTACGTCT
GTTTCACCAGCTTGACGACGAGAACAACCCGGTACAGGAAAATATATTTGACTCGACACCGGCGCTGGAGCTGGT
TGAGGAGCTCATGCAAAAGACAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCTCTTCT
TCGCCGCCAGGCCTCTCCCAATCCGCGTCGCCTGCAGACTTTTGTCGAGCGCATGACGGCCCTTGGCTACGATGT
GGATGCGTCGGGAAGCGGAGCTCTTCAGAACAGCTTGTTCAAGATTGACGACGCTGAGCTTCGCAAGGGCATGGA
GACATTGGTGCTCAAGTCGATGCAGCGCGCCAAGTACTTTATCGCAGGCAAAACTGCCAAGCCATTGTGGCCGCA
CTACTGCCTCAATCTGCCACTTTATACACATTTTACGAGTCCGACGCGTCGCTACGCGGATATTTTGGTGCACCG
ACAACTCGAGGCTGTTTTATCAGAGGGCAAGATTGACTTTACAGATGACATGGAAAGCTTGGTCAAGACGGTTGA
GTCGTGCAATACCAAGAAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATTGAGTCGTGCCGCACCAT
GGACAAGAAGCGACAAGAGGTCAACGGAGACTTGATAGCCGAAGGTGTCGTGCTGTGCGTCTACGAGTCAGCCTT
TGATGTGCTGATTCCAGAGTGGGGGTTTGAGAAGCGAGTGCACTGCGACCAGCTGCCACTCAAGAAGGCTGAATT
TAGAAAGGAGAAGCGAGTGCTCGAGTTGTACTGGGAAAAGGGAGTGCCGAGCTCGGCCTACGTTCCCGAGGACGA
GCGGCCAAAGGCAGCATCATCACAGCGGATTTCGAATGCCATGGCAGCGGCACGGCAGGCAGAAGAGGCGGAAAA
GGCCAGAAAGGAGCGAGAAGAGGCAGCCCGCAAGCAGACTGAGACGGGCACCATGTCGACGGACGATGTCGAGGC
GCTCTTTGACGATGAGGACGACAATACCTCGGACGTGACTGAGGCCATGGCTGGAGCGTCGCTGGCGGAGCGGCC
GACGCAGAGCGTCCCCGGATCGCCGGCGCGCACATCGTCGAATGCCGGCACGCTACATCGAACCCGGTCCGACTC
CAAGGTGCCCATCTCGGAGACGGTTGAGGGACGCCTCACCAACAAGGAGAGATACCTTGATCTGTTCAAGTTGCG
GGAAGAGGGCGGCGACTACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATTATTTTGAAGACGGACCTCAG
CAAGAGCCCGCCGTAAGTCAAGTCTCTCTTTTTTTTTCTTTTTTTCCTTTTTTCATTTTTCTTTTTGTTATGGCG
GGTGAGATGACAAAGGCCAAGCAAAGGAAAAGGACTGACGAGGTGCAAACAGATGCCTGACGATTCGCTCTCTGA
ATCCGTATGCCCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail