Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7752
Gene name
LocationContig_88:16227..20594
Strand+
Gene length (bp)4367
Transcript length (bp)4086
Coding sequence length (bp)4086
Protein length (aa) 1362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 3.8E-77 744 1077
PF17877 Dis3l2_C_term DIS3-like exonuclease 2 C terminal 1.5E-25 1129 1209
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 9.1E-26 637 712

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 415 1359 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 415 1360 0.0E+00
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 413 1181 2.0E-143
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 415 1184 4.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 402 1182 5.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 415 1359 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 415 1360 0.0E+00
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 413 1181 2.0E-143
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 415 1184 4.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 402 1182 5.0E-104
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 402 1182 3.0E-96
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 418 1182 4.0E-94
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 416 1209 5.0E-90
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 551 1158 1.0E-82
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 364 1184 2.0E-66
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 364 1184 2.0E-65
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 639 1159 9.0E-65
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 641 1155 3.0E-64
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 641 1155 3.0E-64
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 641 1155 7.0E-64
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 641 1155 8.0E-64
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 641 1155 2.0E-63
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 628 1159 4.0E-61
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 419 1163 1.0E-60
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 639 1158 3.0E-60
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 404 1158 4.0E-60
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 639 1187 2.0E-59
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 637 1163 3.0E-59
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 637 1155 2.0E-58
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 637 1155 1.0E-57
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 737 1082 3.0E-45
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 690 1216 2.0E-41
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 673 1163 5.0E-40
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 690 1189 1.0E-39
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 738 1080 2.0E-38
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 690 1164 1.0E-37
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 671 1120 3.0E-33
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 687 1170 1.0E-27
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 738 1072 2.0E-27
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 738 1163 6.0E-27
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 660 1076 4.0E-25
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 737 1072 1.0E-24
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 686 1078 2.0E-24
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 744 1163 4.0E-24
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 744 1163 1.0E-23
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 744 1178 1.0E-21
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 736 1072 2.0E-20
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 737 1163 2.0E-20
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 778 1177 4.0E-20
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 737 1163 7.0E-19
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 727 1076 1.0E-16
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 727 1076 4.0E-16
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 727 1076 8.0E-16
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 727 1074 1.0E-15
sp|D3V184|RNB_XENBS Exoribonuclease 2 OS=Xenorhabdus bovienii (strain SS-2004) GN=rnb PE=3 SV=1 737 1078 3.0E-14
sp|B4EW02|RNB_PROMH Exoribonuclease 2 OS=Proteus mirabilis (strain HI4320) GN=rnb PE=3 SV=1 744 1079 2.0E-13
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 742 1084 4.0E-13
sp|B5XS03|RNB_KLEP3 Exoribonuclease 2 OS=Klebsiella pneumoniae (strain 342) GN=rnb PE=3 SV=1 743 1076 5.0E-13
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 743 1076 2.0E-12
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 641 907 5.0E-12
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 727 1074 7.0E-12
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 727 1074 7.0E-12
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 727 1074 1.0E-11
sp|Q7N4F5|RNB_PHOLL Exoribonuclease 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnb PE=3 SV=1 744 1082 2.0E-11
sp|A6T7Z4|RNB_KLEP7 Exoribonuclease 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnb PE=3 SV=1 743 1076 2.0E-11
sp|A4WAX5|RNB_ENT38 Exoribonuclease 2 OS=Enterobacter sp. (strain 638) GN=rnb PE=3 SV=1 744 1076 2.0E-11
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 663 1076 3.0E-11
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 744 871 7.0E-10
sp|Q9ZJX9|RNR_HELPJ Ribonuclease R OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnr PE=3 SV=1 779 1076 2.0E-07
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 744 877 5.0E-07
sp|P39112|DSS1_YEAST Exoribonuclease II, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSS1 PE=1 SV=2 742 1096 8.0E-07
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 408 493 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0140640 catalytic activity, acting on a nucleic acid No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1152
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4783
Ophiocordyceps australis map64 (Brazil) OphauB2|7752 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05838
Ophiocordyceps camponoti-rufipedis Ophun1|648
Ophiocordyceps kimflemingae Ophio5|5818
Ophiocordyceps subramaniannii Hirsu2|10234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7752
MEQQQQQQNKSQQQQSGHGQPSGNVPGPAGRRLHIAHRRSPSELTPLMSMFAANPGIEQLAIQQQIELLQQQQQQ
LQATHQQYVNLGMLPPGQPMAHNGAFNPLQPMANMPQNAFQFPNQIPQQNMAMAPPTQPLSHRRNQSALPNMGMG
MGGPPPAPSSGASGSSFGNFEAPGSHGRENTGGRGGRGGGSASSHQRRHSLALADAKKAAEIAQQKRTTTGFQFP
GPAASSGKIEDENSRMTATHSNLDASVAHGSTRGRGGHGRSQSMATNGRGGTRIAPDAGGDFHRRGGGGGHARTG
SRSFEGNWRTQNQNQDQSGNLNQAFQPGHRPRGSVSQSVSSIGAFQYNPSQPQLMQIPGQIVMPQMFGQQLNAMQ
MNQLQALQAAQMNGQQFQGLQNSQHAGPMGSQQQQQQQQRKTLFTPYLPQASLPALLGDGQLVSGILRVNKKNRS
DAYVTTQDGLLDADIFICGSKDRNRALEGDLVAVELLDVDEVWSQKREKEEKKKRKDITDTRSGSTNQGNHNSSQ
NDDGNTAEGGIRRRGSLRQRPTQKKNDDVEVEGQSLLLVEEEEINDEQKPLYAGHIVAVIERVAGQMFSGTLGLL
RPSSQATKEKQEAERAARDGGNSRHNDTRQPEKPKIVWFKPTDKRVPLIAIPTEQAPRDFVDKHQDYADRIFVAC
IKRWPITSLHPFGTLVEQLGRMGDLKVETDALLRDNNFSSDEFSDAVLRSVGFQDWTLASEDEASIESRRDFREE
QVFTIDFNGSVELGNAVHIKTGADGKIEVGIHVPDVAHFVKPNSLVDREAKKRGTSVQLLNRFCALLPPKLSGEL
CSLQPQEDRLTVSVVFNVNAHTGAVAEGDSWVGRSIVKSAGKLSLQDIDRALGDPTTFSSGAATSKTIQILQGVA
QKFREARLGAGGEPIAPLRLFHQLDDENNPVQENIFDSTPALELVEELMQKTNAYVAQRLAEGLPEKALLRRQAS
PNPRRLQTFVERMTALGYDVDASGSGALQNSLFKIDDAELRKGMETLVLKSMQRAKYFIAGKTAKPLWPHYCLNL
PLYTHFTSPTRRYADILVHRQLEAVLSEGKIDFTDDMESLVKTVESCNTKKDSAQNAQEQSIHIESCRTMDKKRQ
EVNGDLIAEGVVLCVYESAFDVLIPEWGFEKRVHCDQLPLKKAEFRKEKRVLELYWEKGVPSSAYVPEDERPKAA
SSQRISNAMAAARQAEEAEKARKEREEAARKQTETGTMSTDDVEALFDDEDDNTSDVTEAMAGASLAERPTQSVP
GSPARTSSNAGTLHRTRSDSKVPISETVEGRLTNKERYLDLFKLREEGGDYIQDVTEMTRLPIILKTDLSKSPPC
LTIRSLNPYAL*
Coding >OphauB2|7752
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCTCAACAGCAGCAATCGGGACATGGCCAGCCCTCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGGCTGCACATCGCCCATCGACGGAGCCCCTCGGAGCTGACACCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAATTGAACAGTTGGCAATTCAGCAGCAGATCGAGCTCTTACAGCAGCAGCAGCAGCAG
CTCCAGGCGACGCATCAGCAATATGTCAACCTGGGTATGCTGCCCCCGGGTCAGCCCATGGCCCACAACGGCGCT
TTCAATCCTTTGCAGCCCATGGCCAATATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCCGCAACAGAAC
ATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCGGCTCTACCCAATATGGGCATGGGC
ATGGGCGGCCCACCCCCTGCACCTTCTTCAGGCGCTTCGGGCTCCAGTTTTGGCAACTTTGAGGCTCCCGGCTCC
CATGGCAGAGAAAACACTGGCGGCCGAGGCGGCCGGGGCGGAGGCTCCGCCTCGAGCCATCAGCGAAGACATTCT
CTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATTTCAATTCCCC
GGTCCTGCCGCCTCGTCTGGCAAAATCGAGGACGAAAACAGCAGAATGACCGCCACTCATTCCAACCTTGACGCC
TCTGTCGCCCACGGCTCAACCCGTGGCCGTGGAGGACATGGCCGTAGTCAAAGTATGGCTACCAATGGTCGCGGA
GGCACTCGCATCGCACCCGATGCCGGCGGTGACTTTCATCGGCGCGGCGGCGGCGGCGGTCATGCCCGGACTGGA
TCTCGGAGCTTTGAGGGCAACTGGCGCACTCAAAACCAGAATCAAGATCAGTCTGGCAATTTGAACCAGGCTTTT
CAGCCCGGTCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTTTCAATATAATCCAAGC
CAGCCTCAACTCATGCAAATCCCGGGCCAGATTGTGATGCCACAAATGTTTGGCCAGCAGCTCAACGCTATGCAG
ATGAATCAGTTGCAGGCTCTCCAAGCGGCTCAAATGAATGGGCAGCAGTTTCAAGGTCTGCAGAACTCTCAGCAT
GCGGGACCAATGGGGAGTCAGCAGCAGCAACAACAACAGCAGCGCAAGACGCTTTTCACCCCATATTTGCCCCAG
GCCTCCCTCCCTGCCCTCTTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAATAAGAAGAATCGCAGC
GACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCTGACATCTTTATTTGCGGTAGCAAGGACCGCAACCGA
GCCCTCGAGGGCGACTTGGTGGCTGTCGAGCTTCTTGATGTTGATGAGGTTTGGTCTCAGAAGCGAGAGAAGGAG
GAAAAGAAGAAGCGAAAGGACATCACCGACACTCGTTCTGGCTCGACAAATCAAGGCAATCACAATTCTAGTCAG
AATGACGATGGAAACACTGCTGAGGGTGGCATTCGCCGCCGAGGTAGTCTGCGTCAGCGTCCAACTCAAAAGAAG
AACGATGACGTTGAAGTTGAGGGCCAGAGTCTTCTTTTGGTTGAAGAAGAAGAAATCAATGATGAGCAGAAGCCT
CTGTACGCCGGCCACATTGTCGCGGTCATTGAGCGCGTGGCTGGACAAATGTTTTCGGGAACTCTAGGCCTGTTA
CGGCCTAGCAGTCAGGCTACCAAGGAGAAACAGGAAGCTGAAAGAGCCGCTAGGGATGGTGGCAACAGCCGTCAC
AATGATACTCGGCAGCCAGAAAAGCCAAAGATTGTCTGGTTCAAGCCAACGGACAAGCGAGTCCCCTTGATTGCT
ATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGATTACGCTGATCGGATTTTTGTGGCGTGC
ATCAAGCGATGGCCAATCACGTCTCTACATCCCTTTGGCACTTTGGTGGAACAGCTGGGCCGCATGGGTGACCTT
AAGGTGGAAACCGATGCACTGCTTCGAGACAACAACTTTTCGTCTGATGAATTTTCGGATGCTGTGCTTCGCAGC
GTTGGCTTCCAGGACTGGACCTTGGCGAGTGAAGACGAAGCGTCGATAGAAAGTCGCCGTGATTTCCGCGAGGAA
CAAGTCTTCACCATCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCACATCAAGACTGGCGCTGACGGC
AAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCTAGTGGATAGAGAGGCC
AAGAAGCGTGGCACATCGGTGCAGCTCCTCAATCGGTTCTGTGCGCTGCTTCCGCCCAAGCTGTCGGGTGAGCTT
TGCTCTCTGCAGCCTCAAGAGGATCGCTTGACGGTGAGCGTTGTGTTCAATGTGAATGCGCACACTGGCGCGGTT
GCCGAGGGTGACAGCTGGGTTGGACGCAGCATCGTCAAGAGCGCAGGCAAGCTGTCACTCCAAGACATTGACAGG
GCGCTTGGGGATCCAACAACCTTTTCGAGCGGAGCGGCGACGAGCAAGACTATTCAGATTCTGCAAGGCGTGGCA
CAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGAGAACCGATTGCGCCGCTACGTCTGTTTCACCAGCTTGAC
GACGAGAACAACCCGGTACAGGAAAATATATTTGACTCGACACCGGCGCTGGAGCTGGTTGAGGAGCTCATGCAA
AAGACAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCTCTTCTTCGCCGCCAGGCCTCT
CCCAATCCGCGTCGCCTGCAGACTTTTGTCGAGCGCATGACGGCCCTTGGCTACGATGTGGATGCGTCGGGAAGC
GGAGCTCTTCAGAACAGCTTGTTCAAGATTGACGACGCTGAGCTTCGCAAGGGCATGGAGACATTGGTGCTCAAG
TCGATGCAGCGCGCCAAGTACTTTATCGCAGGCAAAACTGCCAAGCCATTGTGGCCGCACTACTGCCTCAATCTG
CCACTTTATACACATTTTACGAGTCCGACGCGTCGCTACGCGGATATTTTGGTGCACCGACAACTCGAGGCTGTT
TTATCAGAGGGCAAGATTGACTTTACAGATGACATGGAAAGCTTGGTCAAGACGGTTGAGTCGTGCAATACCAAG
AAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATTGAGTCGTGCCGCACCATGGACAAGAAGCGACAA
GAGGTCAACGGAGACTTGATAGCCGAAGGTGTCGTGCTGTGCGTCTACGAGTCAGCCTTTGATGTGCTGATTCCA
GAGTGGGGGTTTGAGAAGCGAGTGCACTGCGACCAGCTGCCACTCAAGAAGGCTGAATTTAGAAAGGAGAAGCGA
GTGCTCGAGTTGTACTGGGAAAAGGGAGTGCCGAGCTCGGCCTACGTTCCCGAGGACGAGCGGCCAAAGGCAGCA
TCATCACAGCGGATTTCGAATGCCATGGCAGCGGCACGGCAGGCAGAAGAGGCGGAAAAGGCCAGAAAGGAGCGA
GAAGAGGCAGCCCGCAAGCAGACTGAGACGGGCACCATGTCGACGGACGATGTCGAGGCGCTCTTTGACGATGAG
GACGACAATACCTCGGACGTGACTGAGGCCATGGCTGGAGCGTCGCTGGCGGAGCGGCCGACGCAGAGCGTCCCC
GGATCGCCGGCGCGCACATCGTCGAATGCCGGCACGCTACATCGAACCCGGTCCGACTCCAAGGTGCCCATCTCG
GAGACGGTTGAGGGACGCCTCACCAACAAGGAGAGATACCTTGATCTGTTCAAGTTGCGGGAAGAGGGCGGCGAC
TACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATTATTTTGAAGACGGACCTCAGCAAGAGCCCGCCATGC
CTGACGATTCGCTCTCTGAATCCGTATGCCCTGTAA
Transcript >OphauB2|7752
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCTCAACAGCAGCAATCGGGACATGGCCAGCCCTCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGGCTGCACATCGCCCATCGACGGAGCCCCTCGGAGCTGACACCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAATTGAACAGTTGGCAATTCAGCAGCAGATCGAGCTCTTACAGCAGCAGCAGCAGCAG
CTCCAGGCGACGCATCAGCAATATGTCAACCTGGGTATGCTGCCCCCGGGTCAGCCCATGGCCCACAACGGCGCT
TTCAATCCTTTGCAGCCCATGGCCAATATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCCGCAACAGAAC
ATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCGGCTCTACCCAATATGGGCATGGGC
ATGGGCGGCCCACCCCCTGCACCTTCTTCAGGCGCTTCGGGCTCCAGTTTTGGCAACTTTGAGGCTCCCGGCTCC
CATGGCAGAGAAAACACTGGCGGCCGAGGCGGCCGGGGCGGAGGCTCCGCCTCGAGCCATCAGCGAAGACATTCT
CTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATTTCAATTCCCC
GGTCCTGCCGCCTCGTCTGGCAAAATCGAGGACGAAAACAGCAGAATGACCGCCACTCATTCCAACCTTGACGCC
TCTGTCGCCCACGGCTCAACCCGTGGCCGTGGAGGACATGGCCGTAGTCAAAGTATGGCTACCAATGGTCGCGGA
GGCACTCGCATCGCACCCGATGCCGGCGGTGACTTTCATCGGCGCGGCGGCGGCGGCGGTCATGCCCGGACTGGA
TCTCGGAGCTTTGAGGGCAACTGGCGCACTCAAAACCAGAATCAAGATCAGTCTGGCAATTTGAACCAGGCTTTT
CAGCCCGGTCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTTTCAATATAATCCAAGC
CAGCCTCAACTCATGCAAATCCCGGGCCAGATTGTGATGCCACAAATGTTTGGCCAGCAGCTCAACGCTATGCAG
ATGAATCAGTTGCAGGCTCTCCAAGCGGCTCAAATGAATGGGCAGCAGTTTCAAGGTCTGCAGAACTCTCAGCAT
GCGGGACCAATGGGGAGTCAGCAGCAGCAACAACAACAGCAGCGCAAGACGCTTTTCACCCCATATTTGCCCCAG
GCCTCCCTCCCTGCCCTCTTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAATAAGAAGAATCGCAGC
GACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCTGACATCTTTATTTGCGGTAGCAAGGACCGCAACCGA
GCCCTCGAGGGCGACTTGGTGGCTGTCGAGCTTCTTGATGTTGATGAGGTTTGGTCTCAGAAGCGAGAGAAGGAG
GAAAAGAAGAAGCGAAAGGACATCACCGACACTCGTTCTGGCTCGACAAATCAAGGCAATCACAATTCTAGTCAG
AATGACGATGGAAACACTGCTGAGGGTGGCATTCGCCGCCGAGGTAGTCTGCGTCAGCGTCCAACTCAAAAGAAG
AACGATGACGTTGAAGTTGAGGGCCAGAGTCTTCTTTTGGTTGAAGAAGAAGAAATCAATGATGAGCAGAAGCCT
CTGTACGCCGGCCACATTGTCGCGGTCATTGAGCGCGTGGCTGGACAAATGTTTTCGGGAACTCTAGGCCTGTTA
CGGCCTAGCAGTCAGGCTACCAAGGAGAAACAGGAAGCTGAAAGAGCCGCTAGGGATGGTGGCAACAGCCGTCAC
AATGATACTCGGCAGCCAGAAAAGCCAAAGATTGTCTGGTTCAAGCCAACGGACAAGCGAGTCCCCTTGATTGCT
ATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGATTACGCTGATCGGATTTTTGTGGCGTGC
ATCAAGCGATGGCCAATCACGTCTCTACATCCCTTTGGCACTTTGGTGGAACAGCTGGGCCGCATGGGTGACCTT
AAGGTGGAAACCGATGCACTGCTTCGAGACAACAACTTTTCGTCTGATGAATTTTCGGATGCTGTGCTTCGCAGC
GTTGGCTTCCAGGACTGGACCTTGGCGAGTGAAGACGAAGCGTCGATAGAAAGTCGCCGTGATTTCCGCGAGGAA
CAAGTCTTCACCATCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCACATCAAGACTGGCGCTGACGGC
AAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCTAGTGGATAGAGAGGCC
AAGAAGCGTGGCACATCGGTGCAGCTCCTCAATCGGTTCTGTGCGCTGCTTCCGCCCAAGCTGTCGGGTGAGCTT
TGCTCTCTGCAGCCTCAAGAGGATCGCTTGACGGTGAGCGTTGTGTTCAATGTGAATGCGCACACTGGCGCGGTT
GCCGAGGGTGACAGCTGGGTTGGACGCAGCATCGTCAAGAGCGCAGGCAAGCTGTCACTCCAAGACATTGACAGG
GCGCTTGGGGATCCAACAACCTTTTCGAGCGGAGCGGCGACGAGCAAGACTATTCAGATTCTGCAAGGCGTGGCA
CAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGAGAACCGATTGCGCCGCTACGTCTGTTTCACCAGCTTGAC
GACGAGAACAACCCGGTACAGGAAAATATATTTGACTCGACACCGGCGCTGGAGCTGGTTGAGGAGCTCATGCAA
AAGACAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCTCTTCTTCGCCGCCAGGCCTCT
CCCAATCCGCGTCGCCTGCAGACTTTTGTCGAGCGCATGACGGCCCTTGGCTACGATGTGGATGCGTCGGGAAGC
GGAGCTCTTCAGAACAGCTTGTTCAAGATTGACGACGCTGAGCTTCGCAAGGGCATGGAGACATTGGTGCTCAAG
TCGATGCAGCGCGCCAAGTACTTTATCGCAGGCAAAACTGCCAAGCCATTGTGGCCGCACTACTGCCTCAATCTG
CCACTTTATACACATTTTACGAGTCCGACGCGTCGCTACGCGGATATTTTGGTGCACCGACAACTCGAGGCTGTT
TTATCAGAGGGCAAGATTGACTTTACAGATGACATGGAAAGCTTGGTCAAGACGGTTGAGTCGTGCAATACCAAG
AAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATTGAGTCGTGCCGCACCATGGACAAGAAGCGACAA
GAGGTCAACGGAGACTTGATAGCCGAAGGTGTCGTGCTGTGCGTCTACGAGTCAGCCTTTGATGTGCTGATTCCA
GAGTGGGGGTTTGAGAAGCGAGTGCACTGCGACCAGCTGCCACTCAAGAAGGCTGAATTTAGAAAGGAGAAGCGA
GTGCTCGAGTTGTACTGGGAAAAGGGAGTGCCGAGCTCGGCCTACGTTCCCGAGGACGAGCGGCCAAAGGCAGCA
TCATCACAGCGGATTTCGAATGCCATGGCAGCGGCACGGCAGGCAGAAGAGGCGGAAAAGGCCAGAAAGGAGCGA
GAAGAGGCAGCCCGCAAGCAGACTGAGACGGGCACCATGTCGACGGACGATGTCGAGGCGCTCTTTGACGATGAG
GACGACAATACCTCGGACGTGACTGAGGCCATGGCTGGAGCGTCGCTGGCGGAGCGGCCGACGCAGAGCGTCCCC
GGATCGCCGGCGCGCACATCGTCGAATGCCGGCACGCTACATCGAACCCGGTCCGACTCCAAGGTGCCCATCTCG
GAGACGGTTGAGGGACGCCTCACCAACAAGGAGAGATACCTTGATCTGTTCAAGTTGCGGGAAGAGGGCGGCGAC
TACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATTATTTTGAAGACGGACCTCAGCAAGAGCCCGCCATGC
CTGACGATTCGCTCTCTGAATCCGTATGCCCTGTAA
Gene >OphauB2|7752
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCTCAACAGCAGCAATCGGGACATGGCCAGCCCTCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGGCTGCACATCGCCCATCGACGGAGCCCCTCGGAGCTGACACCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAAGTGAGTTTTTTATTGCCACGATTCTCCCCCTTCACTCCAGCCTTTGGACCAGACTG
GCATCCTGCCCCACGTTTTATTTTTCAGCTTCCTCATCACCTGCCTGATTGTCTTTTCCCACGCCCCTCCCGCTG
ATGATGCTGCCGCTGACGTCTTGTCCTTGTCGCAGTTGAACAGTTGGCAATTCAGCAGCAGATCGAGCTCTTACA
GCAGCAGCAGCAGCAGCTCCAGGCGACGCATCAGCAATATGTCAACCTGGGTATGCTGCCCCCGGGTCAGCCCAT
GGCCCACAACGGCGCTTTCAATCCTTTGCAGCCCATGGCCAATATGCCTCAGAATGCTTTTCAATTCCCAAACCA
GATTCCGCAACAGAACATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCGGCTCTACC
CAATATGGGCATGGGCATGGGCGGCCCACCCCCTGCACCTTCTTCAGGCGCTTCGGGCTCCAGTTTTGGCAACTT
TGAGGCTCCCGGCTCCCATGGCAGAGAAAACACTGGCGGCCGAGGCGGCCGGGGCGGAGGCTCCGCCTCGAGCCA
TCAGCGAAGACATTCTCTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTAC
CGGATTTCAATTCCCCGGTCCTGCCGCCTCGTCTGGCAAAATCGAGGACGAAAACAGCAGAATGACCGCCACTCA
TTCCAACCTTGACGCCTCTGTCGCCCACGGCTCAACCCGTGGCCGTGGAGGACATGGCCGTAGTCAAAGTATGGC
TACCAATGGTCGCGGAGGCACTCGCATCGCACCCGATGCCGGCGGTGACTTTCATCGGCGCGGCGGCGGCGGCGG
TCATGCCCGGACTGGATCTCGGAGCTTTGAGGGCAACTGGCGCACTCAAAACCAGAATCAAGATCAGTCTGGCAA
TTTGAACCAGGCTTTTCAGCCCGGTCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTT
TCAATATAATCCAAGCCAGCCTCAACTCATGCAAATCCCGGGCCAGATTGTGATGCCACAAATGTTTGGCCAGCA
GCTCAACGCTATGCAGATGAATCAGTTGCAGGCTCTCCAAGCGGCTCAAATGAATGGGCAGCAGTTTCAAGGTCT
GCAGAACTCTCAGCATGCGGGACCAATGGGGAGTCAGCAGCAGCAACAACAACAGCAGCGCAAGACGCTTTTCAC
CCCATATTTGCCCCAGGCCTCCCTCCCTGCCCTCTTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAA
TAAGAAGAATCGCAGCGACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCTGACATCTTTATTTGCGGTAG
CAAGGACCGCAACCGAGCCCTCGAGGGCGACTTGGTGGCTGTCGAGCTTCTTGATGTTGATGAGGTTTGGTCTCA
GAAGCGAGAGAAGGAGGAAAAGAAGAAGCGAAAGGACATCACCGACACTCGTTCTGGCTCGACAAATCAAGGCAA
TCACAATTCTAGTCAGAATGACGATGGAAACACTGCTGAGGGTGGCATTCGCCGCCGAGGTAGTCTGCGTCAGCG
TCCAACTCAAAAGAAGAACGATGACGTTGAAGTTGAGGGCCAGAGTCTTCTTTTGGTTGAAGAAGAAGAAATCAA
TGATGAGCAGAAGCCTCTGTACGCCGGCCACATTGTCGCGGTCATTGAGCGCGTGGCTGGACAAATGTTTTCGGG
AACTCTAGGCCTGTTACGGCCTAGCAGTCAGGCTACCAAGGAGAAACAGGAAGCTGAAAGAGCCGCTAGGGATGG
TGGCAACAGCCGTCACAATGATACTCGGCAGCCAGAAAAGCCAAAGATTGTCTGGTTCAAGCCAACGGACAAGCG
AGTCCCCTTGATTGCTATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGATTACGCTGATCG
GATTTTTGTGGCGTGCATCAAGCGATGGCCAATCACGTCTCTACATCCCTTTGGCACTTTGGTGGAACAGCTGGG
CCGCATGGGTGACCTTAAGGTGGAAACCGATGCACTGCTTCGAGACAACAACTTTTCGTCTGATGAATTTTCGGA
TGCTGTGCTTCGCAGCGTTGGCTTCCAGGACTGGACCTTGGCGAGTGAAGACGAAGCGTCGATAGAAAGTCGCCG
TGATTTCCGCGAGGAACAAGTCTTCACCATCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCACATCAA
GACTGGCGCTGACGGCAAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCT
AGTGGATAGAGAGGCCAAGAAGCGTGGCACATCGGTGCAGCTCCTCAATCGGTTCTGTGCGCTGCTTCCGCCCAA
GCTGTCGGGTGAGCTTTGCTCTCTGCAGCCTCAAGAGGATCGCTTGACGGTGAGCGTTGTGTTCAATGTGAATGC
GCACACTGGCGCGGTTGCCGAGGGTGACAGCTGGGTTGGACGCAGCATCGTCAAGAGCGCAGGCAAGCTGTCACT
CCAAGACATTGACAGGGCGCTTGGGGATCCAACAACCTTTTCGAGCGGAGCGGCGACGAGCAAGACTATTCAGAT
TCTGCAAGGCGTGGCACAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGAGAACCGATTGCGCCGCTACGTCT
GTTTCACCAGCTTGACGACGAGAACAACCCGGTACAGGAAAATATATTTGACTCGACACCGGCGCTGGAGCTGGT
TGAGGAGCTCATGCAAAAGACAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCTCTTCT
TCGCCGCCAGGCCTCTCCCAATCCGCGTCGCCTGCAGACTTTTGTCGAGCGCATGACGGCCCTTGGCTACGATGT
GGATGCGTCGGGAAGCGGAGCTCTTCAGAACAGCTTGTTCAAGATTGACGACGCTGAGCTTCGCAAGGGCATGGA
GACATTGGTGCTCAAGTCGATGCAGCGCGCCAAGTACTTTATCGCAGGCAAAACTGCCAAGCCATTGTGGCCGCA
CTACTGCCTCAATCTGCCACTTTATACACATTTTACGAGTCCGACGCGTCGCTACGCGGATATTTTGGTGCACCG
ACAACTCGAGGCTGTTTTATCAGAGGGCAAGATTGACTTTACAGATGACATGGAAAGCTTGGTCAAGACGGTTGA
GTCGTGCAATACCAAGAAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATTGAGTCGTGCCGCACCAT
GGACAAGAAGCGACAAGAGGTCAACGGAGACTTGATAGCCGAAGGTGTCGTGCTGTGCGTCTACGAGTCAGCCTT
TGATGTGCTGATTCCAGAGTGGGGGTTTGAGAAGCGAGTGCACTGCGACCAGCTGCCACTCAAGAAGGCTGAATT
TAGAAAGGAGAAGCGAGTGCTCGAGTTGTACTGGGAAAAGGGAGTGCCGAGCTCGGCCTACGTTCCCGAGGACGA
GCGGCCAAAGGCAGCATCATCACAGCGGATTTCGAATGCCATGGCAGCGGCACGGCAGGCAGAAGAGGCGGAAAA
GGCCAGAAAGGAGCGAGAAGAGGCAGCCCGCAAGCAGACTGAGACGGGCACCATGTCGACGGACGATGTCGAGGC
GCTCTTTGACGATGAGGACGACAATACCTCGGACGTGACTGAGGCCATGGCTGGAGCGTCGCTGGCGGAGCGGCC
GACGCAGAGCGTCCCCGGATCGCCGGCGCGCACATCGTCGAATGCCGGCACGCTACATCGAACCCGGTCCGACTC
CAAGGTGCCCATCTCGGAGACGGTTGAGGGACGCCTCACCAACAAGGAGAGATACCTTGATCTGTTCAAGTTGCG
GGAAGAGGGCGGCGACTACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATTATTTTGAAGACGGACCTCAG
CAAGAGCCCGCCGTAAGTCAAGTCTCTCTTTTTTTTTCTTTTTTTCCTTTTTTCATTTTTCTTTTTGTTATGGCG
GGTGAGATGACAAAGGCCAAGCAAAGGAAAAGGACTGACGAGGTGCAAACAGATGCCTGACGATTCGCTCTCTGA
ATCCGTATGCCCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail