Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7746
Gene name
LocationContig_88:1479..3699
Strand+
Gene length (bp)2220
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.6E-14 159 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 52 578 1.0E-69
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 74 571 4.0E-63
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 155 576 7.0E-61
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 71 582 2.0E-60
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 70 569 7.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 52 578 1.0E-69
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 74 571 4.0E-63
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 155 576 7.0E-61
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 71 582 2.0E-60
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 70 569 7.0E-59
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 160 571 3.0E-58
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 49 571 4.0E-57
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 46 566 9.0E-50
sp|P70158|ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus GN=Smpdl3a PE=1 SV=2 146 577 5.0E-41
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens GN=SMPDL3B PE=2 SV=2 157 567 1.0E-40
sp|Q641Z7|ASM3A_RAT Acid sphingomyelinase-like phosphodiesterase 3a OS=Rattus norvegicus GN=Smpdl3a PE=2 SV=1 163 566 2.0E-40
sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 146 566 8.0E-38
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus GN=Smpdl3b PE=1 SV=1 154 567 1.0E-35
sp|Q3ZC91|ASM3A_BOVIN Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus GN=SMPDL3A PE=2 SV=1 145 566 2.0E-34
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 160 567 1.0E-31
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium discoideum GN=sgmD PE=3 SV=1 160 561 1.0E-18
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 156 426 6.0E-13
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 143 426 2.0E-10
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 160 426 1.0E-09
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 160 426 6.0E-08
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 160 428 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7746
MRSHSLLPLLALSRTVHSDTAAQYSGPDIVASSMSLKSKADAIWEKLKGDASCGGAEALLAIFKGLAVFGDEPVI
KVAQGICKATGKLDADVCDGAIALEGPILADVIRHMTLGSRTSYAFGTTVLGVCGYPDVVPWDVPFPSPKPAGGR
PKPSGKKPLKVVHYSDIHIDEMYQTGANADCSKPICCRPYTEADAPGNAKRAAGPFGDHKCDVPHSLEESMYRAI
NQLVPDAAFSMFTGDIVDHGVWMTSKAANEEKIQNAYNIMNQSLPLIYGTAGNHEAHPVNGFQPNEQGSETSWVY
SLLSSNWNHWVGHFAAESTAMAGSYSAKVPDHNLRIISLNTNFYYRDNFYMYRNMDEKDPNNQISWLVQQLDMAE
KARENVWLIGHMPLGDADALRDQSNYLDQVFKRYSSTIAGGFFGHTHVDHFEISYADYGDRNAQNAFMMSYIAPS
LTPTAGQPAFRVYDVDPETFGVLDSTTYIADMSNADYQTKGPVWTKLYSAKEAYGPLVQPPVTDAKAELTPAFWH
QVTEVMEADGSVFDAYIGRKSRGWQVATCRGECKVQEICQLRAGRAQDNCFKPKGGISFTKRDEGSLNPHGEHDE
CGKPVSMTAFGALTESKDYIKLLLELSEQEIAYHKKAGKKPAGEGDGGQA*
Coding >OphauB2|7746
ATGCGCTCCCACTCTTTGCTTCCTTTGCTGGCTCTGAGCCGCACTGTCCACAGCGACACGGCTGCCCAGTACTCG
GGGCCCGACATTGTGGCGAGTTCCATGAGCCTCAAGTCCAAGGCGGATGCCATTTGGGAGAAACTCAAGGGCGAT
GCATCTTGCGGTGGTGCCGAGGCTCTCCTCGCCATTTTCAAGGGGCTGGCAGTCTTTGGCGATGAACCCGTCATT
AAAGTTGCTCAGGGCATCTGCAAGGCCACAGGAAAACTCGACGCTGATGTATGTGATGGCGCCATTGCTCTCGAA
GGCCCCATTCTCGCCGACGTTATCCGCCACATGACGCTCGGCTCGAGGACCTCGTATGCCTTTGGCACCACTGTC
CTTGGCGTCTGCGGCTACCCTGATGTAGTACCCTGGGATGTGCCATTCCCCTCGCCCAAGCCCGCCGGCGGTCGC
CCCAAGCCTAGCGGCAAGAAGCCACTCAAGGTCGTTCACTACTCGGATATTCACATCGATGAGATGTATCAGACG
GGAGCCAACGCCGATTGCTCCAAGCCAATCTGCTGCAGACCATATACGGAAGCCGATGCTCCTGGAAACGCCAAG
AGGGCTGCTGGACCCTTTGGAGACCACAAGTGCGATGTTCCGCATAGCCTGGAGGAGAGCATGTACAGGGCAATC
AACCAGCTCGTGCCCGATGCAGCCTTTTCCATGTTTACCGGCGATATCGTGGACCATGGTGTCTGGATGACGAGC
AAGGCTGCCAACGAGGAGAAGATCCAAAATGCCTACAATATCATGAATCAGTCTCTTCCCCTCATATATGGCACG
GCTGGCAACCATGAAGCGCACCCAGTTAACGGATTCCAGCCCAACGAACAGGGAAGTGAGACTTCATGGGTCTAT
AGTCTGCTTTCCTCCAACTGGAACCACTGGGTGGGACACTTTGCAGCCGAGAGCACAGCCATGGCAGGCTCCTAC
TCGGCCAAGGTGCCGGATCACAACCTGCGCATCATCTCTCTCAACACCAACTTTTACTACCGCGACAACTTTTAC
ATGTATCGCAACATGGATGAGAAGGACCCCAACAACCAGATTTCGTGGCTGGTGCAGCAGCTCGACATGGCCGAG
AAGGCGCGCGAGAACGTGTGGCTCATTGGACACATGCCTTTGGGCGATGCCGACGCACTGCGCGACCAGTCCAAC
TATCTCGACCAAGTCTTCAAGCGCTATTCATCCACCATTGCTGGCGGCTTCTTTGGCCACACCCACGTCGACCAC
TTTGAAATCAGCTACGCTGACTATGGAGACCGGAATGCCCAAAATGCCTTCATGATGTCCTACATTGCGCCGTCG
CTGACGCCGACGGCTGGACAGCCCGCGTTCCGGGTCTACGATGTTGATCCAGAGACGTTTGGCGTGCTAGATTCA
ACAACGTACATTGCCGACATGTCCAATGCCGACTATCAGACCAAGGGTCCTGTTTGGACCAAGCTTTACTCGGCC
AAGGAGGCATATGGGCCACTTGTCCAGCCACCCGTGACCGACGCCAAGGCGGAGCTGACGCCTGCTTTTTGGCAC
CAGGTAACGGAAGTCATGGAAGCCGACGGCAGCGTATTCGATGCCTACATTGGACGCAAGAGCCGCGGCTGGCAG
GTGGCGACTTGCCGCGGAGAGTGCAAAGTGCAAGAGATATGTCAACTGCGTGCTGGACGGGCCCAGGACAACTGC
TTCAAGCCGAAGGGTGGCATTTCCTTCACCAAACGTGACGAAGGCTCCCTCAACCCCCACGGAGAGCACGATGAG
TGTGGCAAGCCTGTGTCCATGACGGCTTTTGGAGCTCTGACGGAGAGCAAGGATTACATCAAGCTCCTGCTTGAA
TTGTCTGAGCAGGAAATCGCCTATCACAAGAAGGCTGGTAAGAAACCAGCTGGAGAAGGAGATGGGGGACAAGCC
TGA
Transcript >OphauB2|7746
ATGCGCTCCCACTCTTTGCTTCCTTTGCTGGCTCTGAGCCGCACTGTCCACAGCGACACGGCTGCCCAGTACTCG
GGGCCCGACATTGTGGCGAGTTCCATGAGCCTCAAGTCCAAGGCGGATGCCATTTGGGAGAAACTCAAGGGCGAT
GCATCTTGCGGTGGTGCCGAGGCTCTCCTCGCCATTTTCAAGGGGCTGGCAGTCTTTGGCGATGAACCCGTCATT
AAAGTTGCTCAGGGCATCTGCAAGGCCACAGGAAAACTCGACGCTGATGTATGTGATGGCGCCATTGCTCTCGAA
GGCCCCATTCTCGCCGACGTTATCCGCCACATGACGCTCGGCTCGAGGACCTCGTATGCCTTTGGCACCACTGTC
CTTGGCGTCTGCGGCTACCCTGATGTAGTACCCTGGGATGTGCCATTCCCCTCGCCCAAGCCCGCCGGCGGTCGC
CCCAAGCCTAGCGGCAAGAAGCCACTCAAGGTCGTTCACTACTCGGATATTCACATCGATGAGATGTATCAGACG
GGAGCCAACGCCGATTGCTCCAAGCCAATCTGCTGCAGACCATATACGGAAGCCGATGCTCCTGGAAACGCCAAG
AGGGCTGCTGGACCCTTTGGAGACCACAAGTGCGATGTTCCGCATAGCCTGGAGGAGAGCATGTACAGGGCAATC
AACCAGCTCGTGCCCGATGCAGCCTTTTCCATGTTTACCGGCGATATCGTGGACCATGGTGTCTGGATGACGAGC
AAGGCTGCCAACGAGGAGAAGATCCAAAATGCCTACAATATCATGAATCAGTCTCTTCCCCTCATATATGGCACG
GCTGGCAACCATGAAGCGCACCCAGTTAACGGATTCCAGCCCAACGAACAGGGAAGTGAGACTTCATGGGTCTAT
AGTCTGCTTTCCTCCAACTGGAACCACTGGGTGGGACACTTTGCAGCCGAGAGCACAGCCATGGCAGGCTCCTAC
TCGGCCAAGGTGCCGGATCACAACCTGCGCATCATCTCTCTCAACACCAACTTTTACTACCGCGACAACTTTTAC
ATGTATCGCAACATGGATGAGAAGGACCCCAACAACCAGATTTCGTGGCTGGTGCAGCAGCTCGACATGGCCGAG
AAGGCGCGCGAGAACGTGTGGCTCATTGGACACATGCCTTTGGGCGATGCCGACGCACTGCGCGACCAGTCCAAC
TATCTCGACCAAGTCTTCAAGCGCTATTCATCCACCATTGCTGGCGGCTTCTTTGGCCACACCCACGTCGACCAC
TTTGAAATCAGCTACGCTGACTATGGAGACCGGAATGCCCAAAATGCCTTCATGATGTCCTACATTGCGCCGTCG
CTGACGCCGACGGCTGGACAGCCCGCGTTCCGGGTCTACGATGTTGATCCAGAGACGTTTGGCGTGCTAGATTCA
ACAACGTACATTGCCGACATGTCCAATGCCGACTATCAGACCAAGGGTCCTGTTTGGACCAAGCTTTACTCGGCC
AAGGAGGCATATGGGCCACTTGTCCAGCCACCCGTGACCGACGCCAAGGCGGAGCTGACGCCTGCTTTTTGGCAC
CAGGTAACGGAAGTCATGGAAGCCGACGGCAGCGTATTCGATGCCTACATTGGACGCAAGAGCCGCGGCTGGCAG
GTGGCGACTTGCCGCGGAGAGTGCAAAGTGCAAGAGATATGTCAACTGCGTGCTGGACGGGCCCAGGACAACTGC
TTCAAGCCGAAGGGTGGCATTTCCTTCACCAAACGTGACGAAGGCTCCCTCAACCCCCACGGAGAGCACGATGAG
TGTGGCAAGCCTGTGTCCATGACGGCTTTTGGAGCTCTGACGGAGAGCAAGGATTACATCAAGCTCCTGCTTGAA
TTGTCTGAGCAGGAAATCGCCTATCACAAGAAGGCTGGTAAGAAACCAGCTGGAGAAGGAGATGGGGGACAAGCC
TGA
Gene >OphauB2|7746
ATGCGCTCCCACTCTTTGCTTCCTTTGCTGGCTCTGAGCCGCACTGTCCACAGCGACACGGCTGCCCAGTACTCG
GGGCCCGACATTGTGGCGAGTTCCATGAGCCTCAAGTCCAAGGCGGATGCCATTTGGGAGAAACTCAAGGGCGAT
GCATCTTGCGGTGGTGCCGAGGTTGGCTCCCACTTTGCGCCCCTTTACTCCAATTCCCTCCATTTTAGCCCTGGC
GCGCAAAGCTAATTCCAAGCTGTATAGGCTCTCCTCGCCATTTTCAAGGGGCTGGCAGTCTTTGGCGATGAACCC
GTCATTAAAGTTGCTCAGGGCATCTGCAAGGCCACAGGAGTTGGTCTCTCCTTTTGCTTCTTGTTGTTATCACAA
AGCACTGACTCAATTGGCAGAAACTCGACGCTGATGTATGTGATGGCGCCATTGCTCTCGAAGGCCCCATTCTCG
CCGACGTTATCCGCCACATGACGCTCGGCTCGAGGACCTCGTATGCCTTTGGCACCACTGTCCTTGGCGTCTGCG
GCTACCCTGATGTAGTACCCTGGGATGTGCCATTCCCCTCGCCCAAGCCCGCCGGCGGTCGCCCCAAGCCTAGCG
GCAAGAAGCCACTCAAGGTCGTTCACTACTCGGATATTCACATCGATGAGATGTATCAGACGGGAGCCAACGCCG
ATTGCTCCAAGCCAATCTGCTGCAGGTAAGAGCCAAGAAGCGAGCCTTTTGACAAGAGCACGGAATGGTGCTGAT
GCTTGTGCCTTGTAAAAGACCATATACGGAAGCCGATGCTCCTGGAAACGCCAAGAGGGCTGCTGGACCCTTTGG
AGACCACAAGTGCGATGTTCCGCATAGCCTGGAGGAGAGCATGTACAGGGCAATCAACCAGCTCGTGCCCGATGC
AGCCTTTTCCATGTTTACCGGCGATATCGTGGACCATGGTGTCTGGATGACGAGCAAGGCTGCCAACGAGGAGAA
GAGTCAGTTCCAAGCCCTCGACATGTCGTTGCCGCGGCACTTGTGCTAAATCTCAGCTACCTAGTCCAAAATGCC
TACAATATCATGAATCAGTCTCTTCCCCTCATATATGGCACGGCTGGCAACCATGAAGCGCACCCAGTTAACGGA
TTCCAGCCCAACGAACAGGGAAGTGAGACTTCATGGGTCTATAGTCTGCTTTCCTCCAACTGGAACCACTGGGTG
GGACACTTTGCAGCCGAGAGCACAGCCATGGCAGGCTCCTACTCGGCCAAGGTGCCGGATCACAACCTGCGCATC
ATCTCTCTCAACACCAACTTTTACTACCGCGACAACTTTTACATGTATCGCAACATGGATGAGAAGGACCCCAAC
AACCAGATTTCGTGGCTGGTGCAGCAGCTCGACATGGCCGAGAAGGCGCGCGAGAACGTGTGGCTCATTGGACAC
ATGCCTTTGGGCGATGCCGACGCACTGCGCGACCAGTCCAACTATCTCGACCAAGTCTTCAAGCGCTATTCATCC
ACCATTGCTGGCGGCTTCTTTGGCCACACCCACGTCGACCACTTTGAAATCAGCTACGCTGACTATGGAGACCGG
AATGCCCAAAATGCCTTCATGATGTCCTACATTGCGCCGTCGCTGACGCCGACGGCTGGACAGCCCGCGTTCCGG
GTCTACGATGTTGATCCAGAGACGTTTGGCGTGCTAGATTCAACAACGTACATTGCCGACATGTCCAATGCCGAC
TATCAGACCAAGGGTCCTGTTTGGACCAAGCTTTACTCGGCCAAGGAGGCATATGGGCCACTTGTCCAGCCACCC
GTGACCGACGCCAAGGCGGAGCTGACGCCTGCTTTTTGGCACCAGGTAACGGAAGTCATGGAAGCCGACGGCAGC
GTATTCGATGCCTACATTGGACGCAAGAGCCGCGGCTGGCAGGTGGCGACTTGCCGCGGAGAGTGCAAAGTGCAA
GAGATATGTCAACTGCGTGCTGGACGGGCCCAGGACAACTGCTTCAAGCCGAAGGGTGGCATTTCCTTCACCAAA
CGTGACGAAGGCTCCCTCAACCCCCACGGAGAGCACGATGAGTGTGGCAAGCCTGTGTCCATGACGGCTTTTGGA
GCTCTGACGGAGAGCAAGGATTACATCAAGCTCCTGCTTGAATTGTCTGAGCAGGAAATCGCCTATCACAAGAAG
GCTGGTAAGAAACCAGCTGGAGAAGGAGATGGGGGACAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail