Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7741
Gene name
LocationContig_87:65322..65726
Strand+
Gene length (bp)404
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.7E-07 73 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14327|PAB2_SCHPO Polyadenylate-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab2 PE=1 SV=1 19 113 6.0E-36
sp|Q9LX90|PABN3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PABN3 PE=1 SV=1 17 113 2.0E-32
sp|Q9FJN9|PABN2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PABN2 PE=1 SV=1 28 113 1.0E-27
sp|Q93VI4|PABN1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PABN1 PE=1 SV=1 23 113 2.0E-27
sp|Q7KNF2|PABP2_DROME Polyadenylate-binding protein 2 OS=Drosophila melanogaster GN=Pabp2 PE=1 SV=1 29 113 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14327|PAB2_SCHPO Polyadenylate-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab2 PE=1 SV=1 19 113 6.0E-36
sp|Q9LX90|PABN3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PABN3 PE=1 SV=1 17 113 2.0E-32
sp|Q9FJN9|PABN2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PABN2 PE=1 SV=1 28 113 1.0E-27
sp|Q93VI4|PABN1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PABN1 PE=1 SV=1 23 113 2.0E-27
sp|Q7KNF2|PABP2_DROME Polyadenylate-binding protein 2 OS=Drosophila melanogaster GN=Pabp2 PE=1 SV=1 29 113 1.0E-25
sp|Q28ZX3|PABP2_DROPS Polyadenylate-binding protein 2 OS=Drosophila pseudoobscura pseudoobscura GN=Pabp2 PE=3 SV=1 29 113 2.0E-25
sp|Q54ZS8|PABP2_DICDI Polyadenylate-binding protein 2 OS=Dictyostelium discoideum GN=pabpn1 PE=3 SV=1 26 113 2.0E-24
sp|Q6TY21|EPA2B_XENLA Embryonic polyadenylate-binding protein 2-B OS=Xenopus laevis GN=Pabpn1l-b PE=1 SV=1 29 113 1.0E-21
sp|Q804A5|EPA2A_XENLA Embryonic polyadenylate-binding protein 2-A OS=Xenopus laevis GN=Pabpn1l-a PE=1 SV=1 17 113 2.0E-20
sp|Q7ZXB8|PAB2B_XENLA Polyadenylate-binding protein 2-B OS=Xenopus laevis GN=pabpn1-b PE=2 SV=1 26 113 2.0E-19
sp|Q9DDY9|PAB2A_XENLA Polyadenylate-binding protein 2-A OS=Xenopus laevis GN=pabpn1-a PE=2 SV=1 26 113 2.0E-19
sp|Q6NVP7|PABP2_XENTR Polyadenylate-binding protein 2 OS=Xenopus tropicalis GN=pabpn1 PE=2 SV=1 26 113 4.0E-19
sp|Q8CCS6|PABP2_MOUSE Polyadenylate-binding protein 2 OS=Mus musculus GN=Pabpn1 PE=1 SV=3 26 113 5.0E-19
sp|Q28165|PABP2_BOVIN Polyadenylate-binding protein 2 OS=Bos taurus GN=PABPN1 PE=1 SV=3 26 113 5.0E-19
sp|Q86U42|PABP2_HUMAN Polyadenylate-binding protein 2 OS=Homo sapiens GN=PABPN1 PE=1 SV=3 26 113 5.0E-19
sp|A6NDY0|EPAB2_HUMAN Embryonic polyadenylate-binding protein 2 OS=Homo sapiens GN=PABPN1L PE=2 SV=1 63 113 4.0E-16
sp|Q5XFR0|EPAB2_MOUSE Embryonic polyadenylate-binding protein 2 OS=Mus musculus GN=Pabpn1l PE=2 SV=1 41 113 2.0E-15
sp|B0BNE4|EPAB2_RAT Embryonic polyadenylate-binding protein 2 OS=Rattus norvegicus GN=Pabpn1l PE=2 SV=1 65 113 2.0E-14
sp|P40561|SGN1_YEAST RNA-binding protein SGN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGN1 PE=1 SV=1 68 113 5.0E-12
sp|Q09295|YQO4_CAEEL Putative RNA-binding protein EEED8.4 OS=Caenorhabditis elegans GN=EEED8.4 PE=3 SV=2 39 112 4.0E-11
sp|Q09301|YQOC_CAEEL Putative RNA-binding protein EEED8.12 OS=Caenorhabditis elegans GN=EEED8.12 PE=3 SV=1 39 112 4.0E-11
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 59 113 2.0E-08
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 59 113 3.0E-06
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 60 113 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7741
MSDMGKHDDAPTTGEREPDTDIPAGEEEEITAMKRRVAEMEEEAKKLREMQATLEQQSADLSEDKESVDARSIFV
GNVDYSASPEEIQAHFQSCGSINRVTILLDKFTGQPKG*
Coding >OphauB2|7741
ATGTCTGACATGGGTAAACACGACGACGCGCCCACGACGGGTGAGCGCGAACCCGATACGGATATTCCAGCCGGA
GAGGAGGAAGAAATCACTGCCATGAAGCGCCGTGTGGCAGAGATGGAAGAGGAGGCCAAGAAGCTGCGTGAAATG
CAGGCAACACTGGAGCAACAGTCGGCAGACCTCTCTGAGGACAAGGAGTCTGTTGACGCCCGCAGCATCTTTGTC
GGCAATGTCGATTACTCGGCCTCTCCTGAAGAGATACAAGCGCACTTTCAGAGCTGCGGCTCCATCAACCGCGTC
ACGATTTTACTCGACAAATTCACTGGTCAGCCCAAGGGGTAA
Transcript >OphauB2|7741
ATGTCTGACATGGGTAAACACGACGACGCGCCCACGACGGGTGAGCGCGAACCCGATACGGATATTCCAGCCGGA
GAGGAGGAAGAAATCACTGCCATGAAGCGCCGTGTGGCAGAGATGGAAGAGGAGGCCAAGAAGCTGCGTGAAATG
CAGGCAACACTGGAGCAACAGTCGGCAGACCTCTCTGAGGACAAGGAGTCTGTTGACGCCCGCAGCATCTTTGTC
GGCAATGTCGATTACTCGGCCTCTCCTGAAGAGATACAAGCGCACTTTCAGAGCTGCGGCTCCATCAACCGCGTC
ACGATTTTACTCGACAAATTCACTGGTCAGCCCAAGGGGTAA
Gene >OphauB2|7741
ATGTCTGACATGGGTAAACACGACGACGCGCCCACGACGGGTGAGCGCGAACCCGATACGGATATTCCAGCCGGA
GAGGAGGTGCGTTGGGCGCGCGCAAAGAGGAGGAACTTTTGTAAGAAAAACTGACTGGGCGCCGTTAGGAAGAAA
TCACTGCCATGAAGCGCCGTGTGGCAGAGATGGAAGAGGAGGCCAAGAAGCTGCGTGAAATGCAGGCAACACTGG
AGCAACAGTCGGCAGACCTCTCTGAGGACAAGGAGTCTGTTGACGCCCGCAGCATCTTTGTCGGCAATGTCGATT
ACTCGGCCTCTCCTGAAGAGATACAAGCGCACTTTCAGAGCTGCGGCTCCATCAACCGCGTCACGATTTTACTCG
ACAAATTCACTGGTCAGCCCAAGGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail