Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7740
Gene name
LocationContig_87:63208..63850
Strand-
Gene length (bp)642
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 6.5E-07 68 168

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 34 167 6.0E-08
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 34 169 8.0E-08
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 34 169 8.0E-08
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 34 169 8.0E-08
sp|P54282|CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus GN=Cacna1a PE=1 SV=1 34 169 2.0E-07

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0005216 ion channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015267 channel activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 91 113 22
3 134 156 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7740
MSENSASAAPLLPRPNNHGSRSRSTQPLHLRVLRRARRCRSICQRLLMSRAKHFVIMTLVALDVATLLVNIFIQL
IACKMHQNDEPWVLGVAHGLGTAGLIFSCLFLVELIVCLSAFGPRAYFASCFHIFDATIVVLSFFIDVGVTGLAA
NIGSLIIVLRLWRLAKLSEEVVLGATERMAMLEQQLEELESENKHLRLQLGMDSHEHSGSGHE*
Coding >OphauB2|7740
ATGTCAGAAAACAGCGCATCGGCCGCTCCTCTTCTCCCTCGCCCCAACAATCATGGCTCGCGCTCTCGATCGACA
CAGCCGCTACATCTTCGTGTCCTTCGCCGCGCCCGCAGATGTCGCTCAATCTGCCAGCGTCTCCTCATGTCGCGT
GCCAAGCACTTTGTCATCATGACCCTCGTCGCCCTTGATGTTGCCACGCTGCTCGTAAACATCTTTATCCAGCTC
ATTGCATGCAAGATGCATCAAAACGACGAGCCCTGGGTCCTGGGTGTTGCCCATGGCCTTGGCACGGCAGGCCTC
ATCTTTAGCTGTCTCTTCCTCGTCGAGCTCATTGTCTGCCTCTCAGCCTTTGGGCCACGCGCCTACTTTGCCTCA
TGCTTCCATATATTCGATGCCACCATTGTCGTCTTGAGCTTCTTCATCGACGTCGGCGTTACTGGCCTCGCCGCT
AACATTGGCTCGCTCATCATTGTCCTTCGTCTCTGGCGCCTGGCCAAGCTTTCAGAAGAGGTCGTCCTTGGTGCC
ACGGAACGCATGGCAATGCTTGAACAGCAGCTCGAGGAGCTTGAAAGCGAAAACAAGCATCTTCGACTCCAGCTC
GGAATGGATTCACACGAGCACTCTGGTTCTGGTCATGAGTAG
Transcript >OphauB2|7740
ATGTCAGAAAACAGCGCATCGGCCGCTCCTCTTCTCCCTCGCCCCAACAATCATGGCTCGCGCTCTCGATCGACA
CAGCCGCTACATCTTCGTGTCCTTCGCCGCGCCCGCAGATGTCGCTCAATCTGCCAGCGTCTCCTCATGTCGCGT
GCCAAGCACTTTGTCATCATGACCCTCGTCGCCCTTGATGTTGCCACGCTGCTCGTAAACATCTTTATCCAGCTC
ATTGCATGCAAGATGCATCAAAACGACGAGCCCTGGGTCCTGGGTGTTGCCCATGGCCTTGGCACGGCAGGCCTC
ATCTTTAGCTGTCTCTTCCTCGTCGAGCTCATTGTCTGCCTCTCAGCCTTTGGGCCACGCGCCTACTTTGCCTCA
TGCTTCCATATATTCGATGCCACCATTGTCGTCTTGAGCTTCTTCATCGACGTCGGCGTTACTGGCCTCGCCGCT
AACATTGGCTCGCTCATCATTGTCCTTCGTCTCTGGCGCCTGGCCAAGCTTTCAGAAGAGGTCGTCCTTGGTGCC
ACGGAACGCATGGCAATGCTTGAACAGCAGCTCGAGGAGCTTGAAAGCGAAAACAAGCATCTTCGACTCCAGCTC
GGAATGGATTCACACGAGCACTCTGGTTCTGGTCATGAGTAG
Gene >OphauB2|7740
ATGTCAGAAAACAGCGCATCGGCCGCTCCTCTTCTCCCTCGCCCCAACAATCATGGCTCGCGCTCTCGATCGACA
CAGCCGCTACATCTTCGTGTCCTTCGCCGCGCCCGCAGATGTCGCTCAATCTGCCAGCGTCTCCTCATGTCGCGT
GCCAAGCACTTTGTCATCATGACCCTCGTCGCCCTTGATGTTGCCACGCTGCTCGTAAACATCTTTATCCAGCTC
ATTGCATGCAAGATGCATCAAAACGACGAGCCCTGGGTCCTGGGTGTTGCCCATGGCCTTGGCACGGCAGGCCTC
ATCTTTAGCTGTCTCTTCCTCGTCGAGCTCATTGTCTGCCTCTCAGCCTTTGGGCCACGCGCCTACTTTGCCTCA
TGCTTCCATATATTCGATGCCACCATTGTCGTCTTGAGCTTCTTCATCGACGTCGGCGTTACTGGCCTCGCCGCT
AACATTGGCTCGCTCATCATTGTCCTTCGTCTCTGGCGCCTGGCCAAGCTTTCAGAAGAGGTCGTCCTTGGTGCC
ACGGAACGCATGGCAATGCTTGAACAGCAGCTCGAGGAGCTTGAAAGCGAAAACAAGCATCTTCGACTCCAGCTC
GGAATGGATTCACACGAGCACTCTGGTTCTGGTCATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail