Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7738
Gene name
LocationContig_87:57233..60895
Strand-
Gene length (bp)3662
Transcript length (bp)3363
Coding sequence length (bp)3363
Protein length (aa) 1121

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 1.2E-81 191 465
PF09111 SLIDE SLIDE 3.8E-43 915 1030
PF09110 HAND HAND 2.7E-34 753 857
PF00271 Helicase_C Helicase conserved C-terminal domain 8.4E-18 488 600
PF04851 ResIII Type III restriction enzyme, res subunit 1.1E-09 181 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 76 1040 0.0E+00
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 87 1041 0.0E+00
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 74 1033 0.0E+00
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 87 1029 0.0E+00
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 82 1029 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 76 1040 0.0E+00
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 87 1041 0.0E+00
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 74 1033 0.0E+00
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 87 1029 0.0E+00
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 82 1029 0.0E+00
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 82 1029 0.0E+00
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 82 1029 0.0E+00
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 87 1032 0.0E+00
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 74 1029 0.0E+00
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 91 1032 0.0E+00
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 91 1032 0.0E+00
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 91 1032 0.0E+00
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 177 1093 2.0E-148
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 169 702 3.0E-143
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 169 702 1.0E-142
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 175 664 4.0E-140
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 175 696 2.0E-139
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 171 722 4.0E-139
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 173 664 3.0E-138
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 175 697 2.0E-135
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 102 707 3.0E-135
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 171 696 9.0E-135
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 131 696 3.0E-134
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 169 694 1.0E-133
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 169 694 1.0E-133
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 167 638 1.0E-133
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 168 709 2.0E-133
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 167 638 4.0E-133
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 177 692 4.0E-133
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 95 639 1.0E-132
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 175 695 4.0E-132
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 168 659 6.0E-132
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 168 638 7.0E-132
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 168 638 8.0E-132
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 168 638 9.0E-132
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 168 638 9.0E-131
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 182 699 1.0E-130
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 126 639 3.0E-130
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 182 699 1.0E-127
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 130 715 5.0E-127
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 171 666 7.0E-127
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 171 698 1.0E-126
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 171 700 5.0E-126
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 171 700 9.0E-126
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 171 682 1.0E-125
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 143 695 2.0E-125
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 171 694 3.0E-125
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 182 671 4.0E-125
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 182 699 6.0E-125
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 171 666 1.0E-124
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 182 692 1.0E-124
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 182 692 8.0E-124
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 182 692 1.0E-123
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 182 692 2.0E-123
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 182 708 2.0E-123
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 182 708 3.0E-123
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 182 696 3.0E-123
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 180 665 4.0E-123
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 182 692 7.0E-123
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 182 692 1.0E-122
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 180 698 1.0E-120
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 180 698 2.0E-120
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 182 692 2.0E-120
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 182 692 2.0E-120
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 182 692 3.0E-120
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 182 692 3.0E-120
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 182 692 6.0E-119
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 182 661 1.0E-116
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 171 693 2.0E-116
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 141 635 7.0E-113
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 180 665 1.0E-108
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 168 633 8.0E-106
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 181 632 5.0E-105
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 172 632 3.0E-103
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 181 632 6.0E-103
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 175 632 1.0E-102
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 181 632 2.0E-101
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 181 632 3.0E-101
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 171 682 1.0E-99
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 182 632 2.0E-97
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 182 632 5.0E-97
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 144 681 6.0E-88
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 175 642 2.0E-87
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 178 638 1.0E-86
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 182 639 2.0E-84
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 175 651 4.0E-84
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 181 631 5.0E-82
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 175 690 3.0E-80
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 138 715 2.0E-78
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 171 646 4.0E-78
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 175 642 5.0E-78
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 182 643 8.0E-75
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 175 663 2.0E-74
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 152 476 3.0E-74
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 143 479 9.0E-74
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 173 477 6.0E-73
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 90 476 8.0E-73
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 120 505 1.0E-72
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 90 476 2.0E-72
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 150 474 3.0E-72
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 175 468 3.0E-72
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 175 477 4.0E-72
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 175 477 4.0E-72
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 175 514 5.0E-72
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 173 476 5.0E-72
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 175 467 6.0E-72
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 175 477 6.0E-72
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 144 476 9.0E-72
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 173 476 1.0E-71
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 175 477 1.0E-71
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 175 477 1.0E-71
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 173 476 2.0E-71
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 90 470 3.0E-71
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 122 490 4.0E-71
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 90 476 4.0E-71
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 182 636 5.0E-71
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 178 636 7.0E-71
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 114 478 7.0E-71
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 175 627 9.0E-71
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 117 467 1.0E-70
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 174 467 1.0E-70
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 142 467 3.0E-70
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 175 477 5.0E-70
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 178 636 6.0E-70
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 175 635 9.0E-70
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 90 476 1.0E-69
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 90 476 2.0E-69
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 175 652 4.0E-69
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 175 492 7.0E-69
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 175 466 1.0E-68
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 173 476 2.0E-68
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 175 492 2.0E-68
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 173 476 2.0E-68
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 177 635 3.0E-68
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 90 470 4.0E-68
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 173 474 5.0E-68
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 175 506 6.0E-68
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 175 506 6.0E-68
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 184 623 1.0E-67
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 166 466 1.0E-67
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 175 467 2.0E-67
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 175 467 3.0E-67
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 175 467 4.0E-67
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 175 532 6.0E-67
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 175 476 9.0E-67
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 174 636 1.0E-66
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 173 467 1.0E-66
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 175 656 2.0E-66
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 182 656 4.0E-66
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 171 442 5.0E-66
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 175 652 1.0E-65
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 175 475 2.0E-65
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 74 467 3.0E-65
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 175 467 3.0E-65
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 175 652 3.0E-64
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 175 467 3.0E-64
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 175 467 3.0E-64
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 181 630 7.0E-64
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 142 639 9.0E-63
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 182 635 4.0E-62
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 182 640 3.0E-61
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 444 694 7.0E-61
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 193 651 2.0E-59
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 182 640 5.0E-59
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 177 635 5.0E-59
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 193 651 9.0E-59
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 193 651 1.0E-58
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 193 651 1.0E-58
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 177 635 1.0E-58
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 177 635 1.0E-58
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 193 651 1.0E-58
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 177 635 2.0E-58
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 177 635 2.0E-58
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 204 637 3.0E-58
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 177 635 4.0E-58
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 177 635 5.0E-58
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 180 630 8.0E-58
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 177 637 2.0E-57
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 177 635 3.0E-57
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 177 635 7.0E-57
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 177 637 1.0E-56
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 157 637 2.0E-56
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 204 635 3.0E-55
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 200 641 5.0E-55
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 177 635 1.0E-54
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 479 642 2.0E-48
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 173 490 1.0E-47
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 481 656 4.0E-47
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 480 638 5.0E-47
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 133 490 6.0E-47
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 481 640 1.0E-46
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 481 635 1.0E-46
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 481 640 1.0E-46
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 481 640 1.0E-46
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 481 651 1.0E-46
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 479 638 1.0E-46
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 481 640 2.0E-46
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 479 638 2.0E-46
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 481 640 3.0E-46
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 481 640 5.0E-46
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 481 641 2.0E-45
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 481 638 4.0E-45
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 479 638 4.0E-45
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 481 643 7.0E-45
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 479 653 2.0E-44
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 481 638 2.0E-44
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 479 635 3.0E-44
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 173 637 6.0E-44
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 481 652 5.0E-43
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 479 641 2.0E-42
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 479 641 2.0E-42
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 481 657 2.0E-42
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 479 636 3.0E-42
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 481 638 4.0E-42
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 479 636 7.0E-42
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 463 638 1.0E-41
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 154 658 1.0E-41
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 481 670 2.0E-41
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 481 670 2.0E-41
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 481 638 3.0E-41
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 481 638 3.0E-41
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 173 628 3.0E-41
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 481 638 5.0E-41
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 481 638 6.0E-41
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 481 730 8.0E-41
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 457 636 1.0E-40
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 481 638 1.0E-40
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 479 662 2.0E-40
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 481 638 2.0E-40
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 170 630 2.0E-40
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 167 635 4.0E-40
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 481 638 6.0E-40
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 481 688 6.0E-40
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 481 638 6.0E-40
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 481 672 6.0E-40
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 475 718 7.0E-40
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 478 638 1.0E-39
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 167 645 5.0E-39
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 448 668 1.0E-38
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 481 638 1.0E-38
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 483 638 4.0E-38
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 481 638 2.0E-37
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 485 638 2.0E-37
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 204 620 1.0E-30
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 180 630 3.0E-28
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 204 626 4.0E-28
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 175 630 2.0E-27
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 181 630 2.0E-27
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 182 630 2.0E-27
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 91 630 3.0E-27
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 204 630 7.0E-27
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 175 626 9.0E-27
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 176 463 4.0E-26
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 193 626 6.0E-26
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 175 657 1.0E-25
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 175 628 2.0E-25
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 182 463 5.0E-25
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 477 637 1.0E-24
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 157 470 1.0E-24
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 157 470 2.0E-24
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 478 641 3.0E-24
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 478 641 4.0E-24
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 478 641 4.0E-24
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 482 635 4.0E-24
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 181 611 1.0E-23
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 483 628 2.0E-23
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 483 628 4.0E-23
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 182 470 4.0E-23
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 156 643 4.0E-23
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 200 467 2.0E-22
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 200 467 2.0E-22
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 200 467 2.0E-22
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 200 467 2.0E-22
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 481 635 1.0E-21
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 481 635 1.0E-21
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 199 635 1.0E-21
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 307 660 1.0E-21
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 485 630 3.0E-21
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 485 630 2.0E-20
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 203 466 3.0E-20
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 175 637 3.0E-20
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 203 465 4.0E-20
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 203 465 4.0E-20
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 503 638 1.0E-19
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 503 638 1.0E-19
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 169 428 1.0E-19
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 113 659 2.0E-19
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 196 464 2.0E-19
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 203 481 2.0E-19
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 486 621 3.0E-19
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 485 634 6.0E-19
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 494 627 1.0E-18
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 504 661 2.0E-18
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 502 637 2.0E-18
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 484 630 2.0E-18
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 484 630 3.0E-18
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 203 462 5.0E-18
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 484 622 5.0E-18
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 504 622 6.0E-18
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 506 651 7.0E-18
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 498 621 1.0E-17
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 198 465 1.0E-17
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 466 622 1.0E-17
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 185 356 2.0E-17
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 497 622 2.0E-17
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 204 652 2.0E-17
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 493 646 2.0E-17
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 485 621 3.0E-17
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 483 622 6.0E-17
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 485 630 1.0E-16
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 504 646 1.0E-16
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 480 634 1.0E-16
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 181 469 2.0E-16
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 204 637 2.0E-16
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 198 465 2.0E-16
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 484 621 2.0E-16
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 198 465 3.0E-16
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 203 469 3.0E-16
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 198 470 3.0E-16
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 499 652 6.0E-16
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 495 652 1.0E-15
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 485 641 2.0E-15
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 203 469 3.0E-15
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 185 362 3.0E-15
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 235 465 4.0E-15
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 203 462 4.0E-15
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 203 499 1.0E-14
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 497 642 2.0E-14
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 235 469 3.0E-14
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 504 643 3.0E-14
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 174 465 4.0E-14
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 235 466 9.0E-14
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 485 678 1.0E-13
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 483 630 4.0E-13
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 299 467 5.0E-13
sp|Q9M658|MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana GN=MOM1 PE=1 SV=1 456 634 5.0E-13
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 203 466 6.0E-13
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 235 468 9.0E-13
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 235 468 1.0E-12
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 203 460 2.0E-12
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 235 466 2.0E-12
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 483 628 2.0E-12
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 485 637 2.0E-12
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 481 637 3.0E-12
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 503 627 4.0E-10
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 497 620 1.0E-09
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 299 467 2.0E-09
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 115 358 2.0E-09
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 497 620 2.0E-09
sp|Q2NVX0|RAPA_SODGM RNA polymerase-associated protein RapA OS=Sodalis glossinidius (strain morsitans) GN=rapA PE=3 SV=1 204 367 7.0E-09
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 175 428 8.0E-09
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 175 428 3.0E-08
sp|B1JKV7|RAPA_YERPY RNA polymerase-associated protein RapA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rapA PE=3 SV=1 204 367 1.0E-07
sp|Q66EN4|RAPA_YERPS RNA polymerase-associated protein RapA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rapA PE=3 SV=1 204 367 1.0E-07
sp|B2K4B3|RAPA_YERPB RNA polymerase-associated protein RapA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rapA PE=3 SV=1 204 367 1.0E-07
sp|A7FM96|RAPA_YERP3 RNA polymerase-associated protein RapA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rapA PE=3 SV=1 204 367 1.0E-07
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 175 428 2.0E-07
sp|A4TQB3|RAPA_YERPP RNA polymerase-associated protein RapA OS=Yersinia pestis (strain Pestoides F) GN=rapA PE=3 SV=1 204 367 2.0E-07
sp|Q1CMQ6|RAPA_YERPN RNA polymerase-associated protein RapA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rapA PE=3 SV=1 204 367 2.0E-07
sp|A9R154|RAPA_YERPG RNA polymerase-associated protein RapA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rapA PE=3 SV=1 204 367 2.0E-07
sp|Q8ZII0|RAPA_YERPE RNA polymerase-associated protein RapA OS=Yersinia pestis GN=rapA PE=3 SV=1 204 367 2.0E-07
sp|Q1C1Y2|RAPA_YERPA RNA polymerase-associated protein RapA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rapA PE=3 SV=1 204 367 2.0E-07
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 203 483 2.0E-07
sp|A8FQW4|RAPA_SHESH RNA polymerase-associated protein RapA OS=Shewanella sediminis (strain HAW-EB3) GN=rapA PE=3 SV=1 204 367 3.0E-07
sp|B1KJA5|RAPA_SHEWM RNA polymerase-associated protein RapA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rapA PE=3 SV=1 204 367 5.0E-07
sp|A1JJG0|RAPA_YERE8 RNA polymerase-associated protein RapA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rapA PE=3 SV=1 204 367 6.0E-07
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 494 619 7.0E-07
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 504 633 2.0E-06
sp|A3QA31|RAPA_SHELP RNA polymerase-associated protein RapA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rapA PE=3 SV=1 204 367 2.0E-06
sp|A7MIC1|RAPA_CROS8 RNA polymerase-associated protein RapA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rapA PE=3 SV=1 204 367 2.0E-06
sp|Q07XC8|RAPA_SHEFN RNA polymerase-associated protein RapA OS=Shewanella frigidimarina (strain NCIMB 400) GN=rapA PE=3 SV=1 204 367 3.0E-06
sp|A8H8X8|RAPA_SHEPA RNA polymerase-associated protein RapA OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rapA PE=3 SV=1 204 367 4.0E-06
sp|Q12RU8|RAPA_SHEDO RNA polymerase-associated protein RapA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rapA PE=3 SV=1 204 367 4.0E-06
sp|B2VGQ6|RAPA_ERWT9 RNA polymerase-associated protein RapA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rapA PE=3 SV=1 204 367 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0031491 nucleosome binding Yes
GO:0005634 nucleus Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0006338 chromatin remodeling Yes
GO:0044877 protein-containing complex binding No
GO:0006325 chromatin organization No
GO:0097367 carbohydrate derivative binding No
GO:0043226 organelle No
GO:0032553 ribonucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0003682 chromatin binding No
GO:0003676 nucleic acid binding No
GO:0140657 ATP-dependent activity No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0043227 membrane-bounded organelle No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1495
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2414
Ophiocordyceps australis map64 (Brazil) OphauB2|7738 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00950
Ophiocordyceps camponoti-rufipedis Ophun1|4536
Ophiocordyceps kimflemingae Ophio5|2152
Ophiocordyceps subramaniannii Hirsu2|1114

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7738
MAPRPRTSAIDAGAPMSDAPEKPHGEEMEVDETPDYTDSDTNPNTTASSVIGEPVSDGRKRRSEANQLRRSIFGR
KHDRLGESKEDDTIRRFRYLLGLTDLFRHFIETNPDPKIREIMAEIDRQNTEAARAKKGAGRQGGATSDRRRRTE
AEEDAELLKDEKHGGSAETVFRDSPAFIQGTMRDYQIAGLNWLISLHENGISGILADEMGLGKTLQTISFLGYLR
HIAGITGPHLITVPKSTLDNWQREFTRWTPEVNVLVLQGAKDERHNLINERLVDEKFDVCITSYEMILREKAHLK
KFAWEYIIIDEAHRIKNEESSLSQVIRLFNSRNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEAFDQWFSGQD
RDQDTVVQQLHRVLRPFLLRRVKSDVEKSLLPKKEVNLYLGMSEMQVRWYQKILEKDIDAVNGAGGKRESKTRLL
NIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLIYNAGKMVVLDKLLSRLQKQGSRVLIFSQMSRLLDILEDYCVFR
QFKYCRIDGGTAHEDRIAAIDEYNKAGSEKFVFLLTTRAGGLGINLTTADIVILYDSDWNPQADLQAMDRAHRIG
QTKQVVVYRFVTDNAIEEKVLERAAQKLRLDQLVIQQGRAQMVAKAAANKDELLSMIQHGAEKVFQSKGATGNLA
GNGAEIDDDDIEEILARGENRTKQLNSKYEKLGIDDLQKFTSESAYEWNGENFANVKKDIGINWINPAKRERKEQ
SYSMDKYFRQAMFPNPKTEVKPKAPRAPKQVPVHDYQFYPQRLRDLQDRETAFYRKEIGYKIPLADGDDDSLSDR
EAERAQDQQEIDNAVPLTEEERMEKEELSNQGFGNWNKRDFQQFINGSGKYGRSDYEGISQEVDSKTASEVKAYA
KVFWQRYTEIVDNGKHLKVIEDGEERTRRIDNQRKLLRKKMAQYRVPLQQLKINYSVSTTNKKVYTEEEDRFLLV
LLDKYGIDSEGLYEKMRDDIRESPLFRFDWFFLSRTPTELSRRCTTLITTIVKEFDEGPAAGGTRANGVNGKTKR
DADEENDEDSVLGLAPAKKKAKNGVKNKALDNVKSSKTSSAMPSRASSVASSASHNASTPKTKKAKSKKK*
Coding >OphauB2|7738
ATGGCGCCTCGTCCTCGGACTTCGGCCATTGATGCCGGGGCGCCAATGTCGGATGCTCCAGAGAAACCCCATGGA
GAAGAAATGGAAGTTGACGAAACACCCGACTATACCGACTCGGATACCAATCCTAACACGACTGCTAGCAGTGTT
ATTGGCGAGCCTGTTAGCGACGGTCGGAAGCGGCGGTCGGAAGCAAACCAGCTGCGCCGGAGCATCTTTGGCAGA
AAACACGACCGCCTGGGTGAATCCAAAGAAGATGATACTATTCGACGATTCCGCTACTTGCTGGGCCTTACCGAC
CTTTTTAGACATTTCATCGAGACAAATCCAGATCCCAAGATTCGCGAAATCATGGCCGAGATTGATCGCCAAAAC
ACAGAAGCTGCACGAGCCAAAAAGGGCGCTGGCAGACAGGGCGGTGCTACTAGCGACCGGCGACGGCGGACCGAG
GCCGAAGAAGACGCAGAACTGCTCAAGGACGAAAAGCACGGAGGCTCTGCCGAGACAGTCTTCCGCGATTCGCCG
GCATTTATTCAAGGAACCATGAGAGACTACCAGATTGCAGGTCTCAACTGGCTCATTTCTCTGCACGAGAATGGC
ATATCGGGAATCTTGGCCGACGAAATGGGTCTCGGCAAGACTCTGCAAACCATATCATTTCTGGGCTATTTGCGA
CACATTGCTGGCATCACAGGCCCGCACCTCATCACTGTGCCCAAATCTACGCTGGACAACTGGCAGCGTGAATTT
ACGCGGTGGACTCCCGAGGTCAATGTGCTTGTCCTGCAGGGAGCCAAGGATGAACGCCACAATCTCATCAACGAG
CGCCTCGTGGATGAGAAGTTTGATGTCTGCATCACTAGCTACGAAATGATCTTGCGAGAAAAGGCTCATTTGAAA
AAGTTTGCCTGGGAGTACATCATCATTGATGAAGCCCACCGAATCAAGAATGAAGAATCGTCTCTATCGCAAGTC
ATTCGCCTCTTCAACTCTCGCAACCGACTCCTTATTACCGGCACTCCACTACAGAACAATCTGCACGAACTCTGG
GCGCTTCTCAACTTTTTGCTTCCCGATGTCTTTGGCGACTCGGAGGCCTTTGACCAGTGGTTCTCGGGCCAGGAC
CGAGACCAAGATACGGTTGTCCAGCAGCTGCACCGTGTTTTGCGGCCCTTTTTGCTACGCCGCGTCAAGAGTGAC
GTGGAGAAGAGTCTTTTGCCCAAGAAGGAGGTCAACCTGTATCTTGGCATGTCGGAAATGCAGGTTAGGTGGTAT
CAAAAGATTCTCGAAAAGGACATTGACGCGGTCAATGGCGCTGGCGGAAAGCGCGAGTCCAAGACGAGGCTTCTC
AACATTGTGATGCAACTACGTAAATGCTGCAATCACCCCTATCTCTTTGAGGGCGCCGAACCTGGACCGCCTTAT
ACGACGGACGAACATCTCATCTACAATGCGGGCAAAATGGTTGTTCTCGACAAGCTGTTATCGAGACTGCAAAAG
CAAGGCAGCAGAGTCCTCATCTTTTCCCAGATGAGCCGCCTACTTGACATTCTCGAAGATTATTGTGTCTTTAGA
CAGTTTAAATACTGTCGTATTGACGGCGGGACGGCCCACGAAGACCGCATCGCTGCAATTGACGAGTACAACAAG
GCTGGCTCTGAAAAGTTTGTCTTTTTATTGACAACGAGGGCTGGTGGGCTGGGCATCAACCTGACGACGGCGGAT
ATTGTTATTCTCTACGACAGCGACTGGAACCCGCAGGCTGATTTACAGGCCATGGACCGGGCACATCGTATTGGA
CAGACCAAGCAGGTGGTGGTGTACAGATTTGTCACTGATAATGCAATTGAGGAAAAGGTGCTGGAGCGAGCAGCA
CAGAAGCTGCGTCTGGACCAGCTTGTCATTCAACAAGGCCGGGCACAAATGGTTGCCAAGGCTGCGGCCAACAAG
GACGAGCTCCTGTCCATGATTCAGCACGGTGCTGAAAAGGTGTTTCAGTCCAAGGGGGCGACGGGCAATTTGGCG
GGCAACGGGGCTGAAATTGACGATGACGATATCGAAGAGATTTTGGCGCGGGGCGAGAACCGGACCAAGCAGCTC
AACTCAAAGTATGAGAAGCTGGGCATTGACGATTTGCAAAAGTTTACCTCGGAGTCGGCATATGAGTGGAATGGC
GAAAACTTTGCCAATGTCAAAAAGGACATTGGCATCAACTGGATCAATCCGGCCAAGCGTGAGCGCAAGGAGCAG
TCGTATTCCATGGACAAGTACTTTAGGCAGGCCATGTTCCCCAACCCCAAGACGGAGGTGAAGCCCAAGGCTCCT
CGCGCCCCCAAGCAGGTGCCTGTTCACGACTACCAGTTTTATCCGCAGCGCTTGCGAGACTTGCAGGACAGAGAG
ACGGCGTTTTACCGCAAGGAGATTGGGTATAAAATCCCCTTGGCCGACGGCGACGACGACAGCCTGTCTGATCGC
GAAGCCGAACGGGCCCAGGACCAGCAAGAGATTGACAATGCGGTGCCGCTGACGGAAGAAGAGCGCATGGAAAAG
GAGGAGCTCTCGAACCAGGGCTTTGGCAACTGGAACAAGCGAGACTTTCAGCAATTCATTAATGGCTCGGGCAAG
TATGGGCGGTCCGACTATGAAGGCATCTCGCAGGAAGTGGACAGCAAGACGGCGTCTGAAGTCAAGGCGTACGCC
AAGGTGTTTTGGCAGCGCTACACGGAGATTGTCGACAATGGCAAGCACCTCAAGGTTATTGAAGACGGCGAAGAG
CGCACGCGGCGCATCGACAACCAGCGCAAGCTGCTGCGCAAAAAAATGGCGCAGTACCGCGTGCCCCTGCAGCAG
CTCAAGATCAACTACTCGGTATCCACCACCAACAAGAAGGTGTACACGGAGGAGGAGGACCGCTTCCTGCTTGTG
CTGCTGGACAAGTACGGCATCGACTCGGAGGGGCTGTACGAAAAGATGCGCGACGACATTCGCGAGTCGCCCCTC
TTTCGCTTTGACTGGTTCTTTTTGAGCCGCACGCCTACGGAGCTGTCGCGGCGCTGCACGACGCTCATTACGACG
ATTGTAAAGGAGTTTGACGAGGGGCCTGCGGCGGGGGGCACGCGCGCTAATGGCGTGAATGGAAAGACGAAGCGT
GATGCCGATGAAGAGAATGACGAGGATAGCGTGCTGGGGCTGGCGCCGGCAAAGAAGAAGGCCAAGAATGGAGTC
AAGAACAAGGCGCTCGATAACGTCAAGTCGAGCAAGACTAGCTCGGCCATGCCATCACGCGCCTCGAGCGTCGCA
TCTTCGGCATCGCACAACGCCAGTACGCCAAAGACGAAGAAGGCCAAGTCGAAGAAGAAGTAG
Transcript >OphauB2|7738
ATGGCGCCTCGTCCTCGGACTTCGGCCATTGATGCCGGGGCGCCAATGTCGGATGCTCCAGAGAAACCCCATGGA
GAAGAAATGGAAGTTGACGAAACACCCGACTATACCGACTCGGATACCAATCCTAACACGACTGCTAGCAGTGTT
ATTGGCGAGCCTGTTAGCGACGGTCGGAAGCGGCGGTCGGAAGCAAACCAGCTGCGCCGGAGCATCTTTGGCAGA
AAACACGACCGCCTGGGTGAATCCAAAGAAGATGATACTATTCGACGATTCCGCTACTTGCTGGGCCTTACCGAC
CTTTTTAGACATTTCATCGAGACAAATCCAGATCCCAAGATTCGCGAAATCATGGCCGAGATTGATCGCCAAAAC
ACAGAAGCTGCACGAGCCAAAAAGGGCGCTGGCAGACAGGGCGGTGCTACTAGCGACCGGCGACGGCGGACCGAG
GCCGAAGAAGACGCAGAACTGCTCAAGGACGAAAAGCACGGAGGCTCTGCCGAGACAGTCTTCCGCGATTCGCCG
GCATTTATTCAAGGAACCATGAGAGACTACCAGATTGCAGGTCTCAACTGGCTCATTTCTCTGCACGAGAATGGC
ATATCGGGAATCTTGGCCGACGAAATGGGTCTCGGCAAGACTCTGCAAACCATATCATTTCTGGGCTATTTGCGA
CACATTGCTGGCATCACAGGCCCGCACCTCATCACTGTGCCCAAATCTACGCTGGACAACTGGCAGCGTGAATTT
ACGCGGTGGACTCCCGAGGTCAATGTGCTTGTCCTGCAGGGAGCCAAGGATGAACGCCACAATCTCATCAACGAG
CGCCTCGTGGATGAGAAGTTTGATGTCTGCATCACTAGCTACGAAATGATCTTGCGAGAAAAGGCTCATTTGAAA
AAGTTTGCCTGGGAGTACATCATCATTGATGAAGCCCACCGAATCAAGAATGAAGAATCGTCTCTATCGCAAGTC
ATTCGCCTCTTCAACTCTCGCAACCGACTCCTTATTACCGGCACTCCACTACAGAACAATCTGCACGAACTCTGG
GCGCTTCTCAACTTTTTGCTTCCCGATGTCTTTGGCGACTCGGAGGCCTTTGACCAGTGGTTCTCGGGCCAGGAC
CGAGACCAAGATACGGTTGTCCAGCAGCTGCACCGTGTTTTGCGGCCCTTTTTGCTACGCCGCGTCAAGAGTGAC
GTGGAGAAGAGTCTTTTGCCCAAGAAGGAGGTCAACCTGTATCTTGGCATGTCGGAAATGCAGGTTAGGTGGTAT
CAAAAGATTCTCGAAAAGGACATTGACGCGGTCAATGGCGCTGGCGGAAAGCGCGAGTCCAAGACGAGGCTTCTC
AACATTGTGATGCAACTACGTAAATGCTGCAATCACCCCTATCTCTTTGAGGGCGCCGAACCTGGACCGCCTTAT
ACGACGGACGAACATCTCATCTACAATGCGGGCAAAATGGTTGTTCTCGACAAGCTGTTATCGAGACTGCAAAAG
CAAGGCAGCAGAGTCCTCATCTTTTCCCAGATGAGCCGCCTACTTGACATTCTCGAAGATTATTGTGTCTTTAGA
CAGTTTAAATACTGTCGTATTGACGGCGGGACGGCCCACGAAGACCGCATCGCTGCAATTGACGAGTACAACAAG
GCTGGCTCTGAAAAGTTTGTCTTTTTATTGACAACGAGGGCTGGTGGGCTGGGCATCAACCTGACGACGGCGGAT
ATTGTTATTCTCTACGACAGCGACTGGAACCCGCAGGCTGATTTACAGGCCATGGACCGGGCACATCGTATTGGA
CAGACCAAGCAGGTGGTGGTGTACAGATTTGTCACTGATAATGCAATTGAGGAAAAGGTGCTGGAGCGAGCAGCA
CAGAAGCTGCGTCTGGACCAGCTTGTCATTCAACAAGGCCGGGCACAAATGGTTGCCAAGGCTGCGGCCAACAAG
GACGAGCTCCTGTCCATGATTCAGCACGGTGCTGAAAAGGTGTTTCAGTCCAAGGGGGCGACGGGCAATTTGGCG
GGCAACGGGGCTGAAATTGACGATGACGATATCGAAGAGATTTTGGCGCGGGGCGAGAACCGGACCAAGCAGCTC
AACTCAAAGTATGAGAAGCTGGGCATTGACGATTTGCAAAAGTTTACCTCGGAGTCGGCATATGAGTGGAATGGC
GAAAACTTTGCCAATGTCAAAAAGGACATTGGCATCAACTGGATCAATCCGGCCAAGCGTGAGCGCAAGGAGCAG
TCGTATTCCATGGACAAGTACTTTAGGCAGGCCATGTTCCCCAACCCCAAGACGGAGGTGAAGCCCAAGGCTCCT
CGCGCCCCCAAGCAGGTGCCTGTTCACGACTACCAGTTTTATCCGCAGCGCTTGCGAGACTTGCAGGACAGAGAG
ACGGCGTTTTACCGCAAGGAGATTGGGTATAAAATCCCCTTGGCCGACGGCGACGACGACAGCCTGTCTGATCGC
GAAGCCGAACGGGCCCAGGACCAGCAAGAGATTGACAATGCGGTGCCGCTGACGGAAGAAGAGCGCATGGAAAAG
GAGGAGCTCTCGAACCAGGGCTTTGGCAACTGGAACAAGCGAGACTTTCAGCAATTCATTAATGGCTCGGGCAAG
TATGGGCGGTCCGACTATGAAGGCATCTCGCAGGAAGTGGACAGCAAGACGGCGTCTGAAGTCAAGGCGTACGCC
AAGGTGTTTTGGCAGCGCTACACGGAGATTGTCGACAATGGCAAGCACCTCAAGGTTATTGAAGACGGCGAAGAG
CGCACGCGGCGCATCGACAACCAGCGCAAGCTGCTGCGCAAAAAAATGGCGCAGTACCGCGTGCCCCTGCAGCAG
CTCAAGATCAACTACTCGGTATCCACCACCAACAAGAAGGTGTACACGGAGGAGGAGGACCGCTTCCTGCTTGTG
CTGCTGGACAAGTACGGCATCGACTCGGAGGGGCTGTACGAAAAGATGCGCGACGACATTCGCGAGTCGCCCCTC
TTTCGCTTTGACTGGTTCTTTTTGAGCCGCACGCCTACGGAGCTGTCGCGGCGCTGCACGACGCTCATTACGACG
ATTGTAAAGGAGTTTGACGAGGGGCCTGCGGCGGGGGGCACGCGCGCTAATGGCGTGAATGGAAAGACGAAGCGT
GATGCCGATGAAGAGAATGACGAGGATAGCGTGCTGGGGCTGGCGCCGGCAAAGAAGAAGGCCAAGAATGGAGTC
AAGAACAAGGCGCTCGATAACGTCAAGTCGAGCAAGACTAGCTCGGCCATGCCATCACGCGCCTCGAGCGTCGCA
TCTTCGGCATCGCACAACGCCAGTACGCCAAAGACGAAGAAGGCCAAGTCGAAGAAGAAGTAG
Gene >OphauB2|7738
ATGGCGCCTCGTCCTCGGACTTCGGCCATTGATGCCGGGGCGCCAATGTCGGATGCTCCAGAGAAACCCCATGGA
GAAGAAATGGTAGCCTTGATCTGTCGTGGACTCGAATCTCGAGGGAAGCTCTTGAAGCTAATGAGGCCAACAGGA
AGTTGACGAAACACCCGACTATACCGACTCGGATACCAATCCTAACACGACTGCTAGCAGTGTTATTGGCGAGCC
TGTTAGCGACGGTCGGAAGCGGCGGTCGGAAGCAAACCAGCTGCGCCGGAGCATCTTTGGCAGAAAACACGACCG
CCTGGGTGAATCCAAAGTGCGAGCCACTCTAAAATGCCCCCATTTTATTCTTGTAAGCTCTGGTTGCTAAATTTG
GAGGCTATAGGAAGATGATACTATTCGACGATTCCGCTACTTGCTGGGCCTTACCGACCTTTTTAGACATTTCAT
CGAGACAAATCCAGATCCCAAGATTCGCGAAATCATGGCCGAGATTGATCGCCAAAACACAGAAGCTGCACGAGC
CAAAAAGGGCGCTGGCAGACAGGGCGGTGCTACTAGCGACCGGCGACGGCGGACCGAGGCCGAAGAAGACGCAGA
ACTGCTCAAGGACGAAAAGCACGGAGGCTCTGCCGAGACAGTCTTCCGCGATTCGCCGGCATTTATTCAAGGAAC
CATGAGAGACTACCAGATTGCAGGTCTCAACTGGCTCATTTCTCTGCACGAGAATGGCATATCGGGAATCTTGGC
CGACGAAATGGGTCTCGGCAAGACTCTGCAAACCATATCATTTCTGGGCTATTTGCGACACATTGCTGGCATCAC
AGGCCCGCACCTCATCACTGTGCCCAAATCTACGCTGGACAACTGGCAGCGTGAATTTACGCGGTGGACTCCCGA
GGTCAATGTGCTTGTCCTGCAGGGAGCCAAGGATGAACGCCACAATCTCATCAACGAGCGCCTCGTGGATGAGAA
GTTTGATGTCTGCATCACTAGCTACGAAATGATCTTGCGAGAAAAGGCTCATTTGAAAAAGTTTGCCTGGGAGTA
CATCATCATTGATGAAGTAAGTTTTTGCTACAAGTGCCTCGCAAGCGCGCTGCTAACCGAGCCCACAGGCCCACC
GAATCAAGAATGAAGAATCGTCTCTATCGCAAGTCATTCGCCTCTTCAACTCTCGCAACCGACTCCTTATTACCG
GCACTCCACTACAGAACAATCTGCACGAACTCTGGGCGCTTCTCAACTTTTTGCTTCCCGATGTCTTTGGCGACT
CGGAGGCCTTTGACCAGTGGTTCTCGGGCCAGGACCGAGACCAAGATACGGTTGTCCAGCAGCTGCACCGTGTTT
TGCGGCCCTTTTTGCTACGCCGCGTCAAGAGTGACGTGGAGAAGAGTCTTTTGCCCAAGAAGGAGGTCAACCTGT
ATCTTGGCATGTCGGAAATGCAGGTTAGGTGGTATCAAAAGATTCTCGAAAAGGACATTGACGCGGTCAATGGCG
CTGGCGGAAAGCGCGAGTCCAAGACGAGGCTTCTCAACATTGTGATGCAACTACGTAAATGCTGCAATCACCCCT
ATCTCTTTGAGGGCGCCGAACCTGGACCGCCTTATACGACGGACGAACATCTCATCTACAATGCGGGCAAAATGG
TTGTTCTCGACAAGCTGTTATCGAGACTGCAAAAGCAAGGCAGCAGAGTCCTCATCTTTTCCCAGATGAGCCGCC
TACTTGACATTCTCGAAGATTATTGTGTCTTTAGACAGTTTAAATACTGTCGTATTGACGGCGGGACGGCCCACG
AAGACCGCATCGCTGCAATTGACGAGTACAACAAGGCTGGCTCTGAAAAGTTTGTCTTTTTATTGACAACGAGGG
CTGGTGGGCTGGGCATCAACCTGACGACGGCGGATATTGTTATTCTCTACGACAGCGACTGGAACCCGCAGGCTG
ATTTACAGGCCATGGACCGGGCACATCGTATTGGACAGACCAAGCAGGTGGTGGTGTACAGATTTGTCACTGATA
ATGCAATTGAGGAAAAGGTGCTGGAGCGAGCAGCACAGAAGCTGCGTCTGGACCAGCTTGTCATTCAACAAGGCC
GGGCACAAATGGTTGCCAAGGCTGCGGCCAACAAGGACGAGCTCCTGTCCATGATTCAGCACGGTGCTGAAAAGG
TGTTTCAGTCCAAGGGGGCGACGGGCAATTTGGCGGGCAACGGGGCTGAAATTGACGATGACGATATCGAAGAGA
TTTTGGCGCGGGGCGAGAACCGGACCAAGCAGCTCAACTCAAAGTATGAGAAGCTGGGCATTGACGATTTGCAAA
AGTTTACCTCGGAGTCGGCATATGAGTGGAATGGCGAAAACTTTGCCAATGTCAAAAAGGACATTGGCATCAACT
GGATCAATCCGGCCAAGCGTGAGCGCAAGGAGCAGTCGTATTCCATGGACAAGTACTTTAGGCAGGCCATGTTCC
CCAACCCCAAGACGGAGGTGAAGCCCAAGGCTCCTCGCGCCCCCAAGCAGGTGCCTGTTCACGACTACCAGTTTT
ATCCGCAGCGCTTGCGAGACTTGCAGGACAGAGAGACGGCGTTTTACCGCAAGGAGATTGGGTATAAAATCCCCT
TGGCCGACGGCGACGACGACAGCCTGTCTGATCGCGAAGCCGAACGGGCCCAGGACCAGCAAGAGATTGACAATG
CGGTGCCGCTGACGGAAGAAGAGCGCATGGAAAAGGAGGAGCTCTCGAACCAGGGCTTTGGCAACTGGAACAAGC
GAGACTTTCAGCAATTCATTAATGGCTCGGGCAAGTATGGGCGGTCCGACTATGAAGGCATCTCGCAGGAAGTGG
ACAGCAAGACGGCGTCTGAAGTCAAGGCGTACGCCAAGGTGTTTTGGCAGCGCTACACGGAGATTGTCGACAATG
GCAAGCACCTCAAGGTTATTGAAGACGGCGAAGAGCGCACGCGGCGCATCGACAACCAGCGCAAGCTGCTGCGCA
AAAAAATGGCGCAGTACCGCGTGCCCCTGCAGCAGCTCAAGATCAACTACTCGGTATCCACCACCAACAAGAAGG
TGTACACGGAGGAGGAGGACCGCTTCCTGCTTGTGCTGCTGGACAAGTACGGCATCGACTCGGAGGGGCTGTACG
AAAAGATGCGCGACGACATTCGCGAGTCGCCCCTCTTTCGCTTTGACTGGTTCTTTTTGAGCCGCACGCCTACGG
AGCTGTCGCGGCGCTGCACGACGCTCATTACGACGATTGTAAAGGAGTTTGACGAGGGGCCTGCGGCGGGGGGCA
CGCGCGCTAATGGCGTGAATGGAAAGACGAAGCGTGATGCCGATGAAGAGAATGACGAGGATAGCGTGCTGGGGC
TGGCGCCGGCAAAGAAGAAGGCCAAGAATGGAGTCAAGGTGTGTCTCTTTTTTCTTTTTTTTTTTTTTCCTTTTT
TTTTCTTCTCCTTTTTTTTTGAGGCCGGGGGGTTGGTCGTGTTGCAACTCGTGCTTGTTTACTGACTAGTAGAGC
AGAACAAGGCGCTCGATAACGTCAAGTCGAGCAAGACTAGCTCGGCCATGCCATCACGCGCCTCGAGCGTCGCAT
CTTCGGCATCGCACAACGCCAGTACGCCAAAGACGAAGAAGGCCAAGTCGAAGAAGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail