Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7735
Gene name
LocationContig_87:49748..51819
Strand-
Gene length (bp)2071
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.7E-54 64 576

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 86 574 3.0E-25
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 86 574 3.0E-25
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 86 574 9.0E-23
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 86 574 2.0E-22
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 86 574 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 86 574 3.0E-25
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 86 574 3.0E-25
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 86 574 9.0E-23
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 86 574 2.0E-22
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 86 574 3.0E-22
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 104 574 2.0E-21
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 254 576 2.0E-21
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 298 574 3.0E-21
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 86 574 6.0E-21
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 259 574 9.0E-21
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 86 574 1.0E-20
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 299 574 9.0E-20
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 343 573 2.0E-19
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 254 574 2.0E-19
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 343 573 2.0E-19
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 140 576 2.0E-19
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 142 576 3.0E-19
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 299 574 3.0E-19
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 343 573 3.0E-19
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 299 574 4.0E-19
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 137 575 6.0E-19
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 347 573 8.0E-19
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 139 575 8.0E-19
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 88 574 2.0E-18
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 343 574 4.0E-18
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 120 574 5.0E-18
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 343 574 7.0E-18
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 343 575 8.0E-18
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 137 575 1.0E-17
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 334 574 1.0E-17
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 292 576 1.0E-17
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 332 567 1.0E-17
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 98 567 2.0E-17
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 324 575 2.0E-17
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 138 575 2.0E-17
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 259 574 3.0E-17
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 139 575 3.0E-17
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 139 578 4.0E-17
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 86 574 5.0E-17
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 343 567 5.0E-17
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 140 576 6.0E-17
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 298 574 6.0E-17
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 311 574 6.0E-17
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 82 574 1.0E-16
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 311 567 1.0E-16
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 343 574 1.0E-16
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 289 574 1.0E-16
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 299 576 1.0E-16
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 285 573 2.0E-16
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 299 573 2.0E-16
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 79 576 2.0E-16
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 292 573 2.0E-16
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 343 585 2.0E-16
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 343 571 2.0E-16
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 343 578 3.0E-16
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 297 573 3.0E-16
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 104 574 4.0E-16
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 343 573 4.0E-16
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 331 567 4.0E-16
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 331 573 4.0E-16
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 343 571 5.0E-16
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 140 578 6.0E-16
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 359 567 1.0E-15
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 104 574 1.0E-15
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 359 578 1.0E-15
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 247 591 2.0E-15
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 331 567 2.0E-15
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 343 574 3.0E-15
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 128 579 3.0E-15
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 359 567 3.0E-15
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 107 576 3.0E-15
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 343 571 3.0E-15
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 331 573 4.0E-15
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 139 574 5.0E-15
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 297 573 5.0E-15
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 331 571 6.0E-15
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 139 576 7.0E-15
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 202 573 8.0E-15
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 346 581 9.0E-15
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 343 574 1.0E-14
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 139 573 1.0E-14
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 105 576 1.0E-14
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 202 573 1.0E-14
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 359 578 1.0E-14
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 343 574 1.0E-14
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 359 573 1.0E-14
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 343 579 2.0E-14
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 128 578 2.0E-14
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 272 574 2.0E-14
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 342 567 2.0E-14
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 272 574 2.0E-14
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 332 576 2.0E-14
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 104 574 2.0E-14
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 287 576 2.0E-14
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 268 620 3.0E-14
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 343 574 3.0E-14
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 272 574 3.0E-14
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 342 567 3.0E-14
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 290 576 4.0E-14
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 137 569 5.0E-14
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 331 567 5.0E-14
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 335 586 6.0E-14
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 99 578 6.0E-14
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 342 589 6.0E-14
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 359 573 7.0E-14
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 359 573 8.0E-14
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 247 591 9.0E-14
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 359 573 1.0E-13
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 354 573 1.0E-13
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 250 574 1.0E-13
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 343 574 1.0E-13
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 343 573 1.0E-13
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 347 571 1.0E-13
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 343 573 2.0E-13
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 335 575 2.0E-13
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 105 576 2.0E-13
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 359 573 3.0E-13
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 141 578 3.0E-13
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 343 578 3.0E-13
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 343 575 3.0E-13
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 272 574 3.0E-13
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 124 574 3.0E-13
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 359 573 4.0E-13
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 269 574 4.0E-13
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 271 575 4.0E-13
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 343 579 7.0E-13
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 345 576 8.0E-13
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 139 574 9.0E-13
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 136 576 9.0E-13
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 358 573 1.0E-12
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 78 575 1.0E-12
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 335 575 1.0E-12
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 246 591 2.0E-12
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 274 573 2.0E-12
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 343 577 2.0E-12
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 289 576 2.0E-12
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 141 578 2.0E-12
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 133 557 2.0E-12
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 134 575 2.0E-12
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 332 575 2.0E-12
sp|Q9VWR2|CP308_DROME Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 343 579 3.0E-12
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 136 573 4.0E-12
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 343 599 4.0E-12
sp|Q9V676|CP6T3_DROME Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 258 615 4.0E-12
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 107 576 4.0E-12
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 124 574 4.0E-12
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 343 574 6.0E-12
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 343 576 6.0E-12
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 348 575 9.0E-12
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 301 570 9.0E-12
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 127 576 9.0E-12
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 128 575 1.0E-11
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 124 572 1.0E-11
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 343 576 1.0E-11
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 341 574 1.0E-11
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 346 578 1.0E-11
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 88 576 1.0E-11
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 88 576 1.0E-11
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 88 576 1.0E-11
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 292 593 2.0E-11
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 354 578 2.0E-11
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 358 571 2.0E-11
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 289 575 2.0E-11
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 255 578 2.0E-11
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 343 578 3.0E-11
sp|Q02315|CP51_PICKU Lanosterol 14-alpha demethylase (Fragment) OS=Pichia kudriavzevii GN=CYP51 PE=3 SV=1 343 550 3.0E-11
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 255 578 3.0E-11
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 255 578 3.0E-11
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 269 593 3.0E-11
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 343 599 4.0E-11
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 355 571 4.0E-11
sp|Q9VYQ5|CP318_DROME Probable cytochrome P450 318a1 OS=Drosophila melanogaster GN=Cyp318a1 PE=2 SV=4 301 574 5.0E-11
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 285 568 5.0E-11
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 261 573 6.0E-11
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 246 619 6.0E-11
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 355 571 7.0E-11
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 79 579 7.0E-11
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 292 589 7.0E-11
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 133 573 9.0E-11
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 334 571 9.0E-11
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 290 574 9.0E-11
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 355 571 1.0E-10
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 127 578 1.0E-10
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 287 576 1.0E-10
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 289 575 1.0E-10
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 272 576 1.0E-10
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 294 573 1.0E-10
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 343 576 2.0E-10
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 314 576 2.0E-10
sp|Q949U1|C79F1_ARATH Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 342 578 2.0E-10
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 334 575 2.0E-10
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 269 593 2.0E-10
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 314 576 2.0E-10
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 144 580 2.0E-10
sp|Q9W223|CP6D2_DROME Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 139 573 2.0E-10
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 346 573 3.0E-10
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 355 593 3.0E-10
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 333 578 3.0E-10
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 288 573 3.0E-10
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 355 574 3.0E-10
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 355 568 4.0E-10
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 302 571 4.0E-10
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 272 576 4.0E-10
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 64 574 4.0E-10
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 290 571 4.0E-10
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 342 578 6.0E-10
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 355 573 6.0E-10
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 343 595 8.0E-10
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 293 575 9.0E-10
sp|Q9VRI9|CP6T1_DROME Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 266 576 1.0E-09
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 292 575 2.0E-09
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 354 578 2.0E-09
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 345 572 2.0E-09
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 352 575 3.0E-09
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 346 588 4.0E-09
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 347 576 4.0E-09
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 290 575 4.0E-09
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 333 578 4.0E-09
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 355 574 5.0E-09
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 288 576 6.0E-09
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 331 605 7.0E-09
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 254 589 7.0E-09
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 355 575 7.0E-09
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 333 578 7.0E-09
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 328 574 9.0E-09
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 329 571 9.0E-09
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 114 560 1.0E-08
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 345 552 1.0E-08
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 348 585 1.0E-08
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 355 574 1.0E-08
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 299 578 1.0E-08
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 344 579 2.0E-08
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 344 573 2.0E-08
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 333 578 2.0E-08
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 292 579 2.0E-08
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 269 496 2.0E-08
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 340 575 2.0E-08
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 333 578 2.0E-08
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 343 497 3.0E-08
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 343 567 4.0E-08
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 288 576 4.0E-08
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 290 575 4.0E-08
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 299 575 6.0E-08
sp|Q5KQH7|C14D1_ORYSJ Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 332 576 7.0E-08
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 289 573 8.0E-08
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 235 579 9.0E-08
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 343 572 1.0E-07
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 337 509 1.0E-07
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 211 575 1.0E-07
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 341 575 1.0E-07
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 355 591 1.0E-07
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 292 579 2.0E-07
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 292 579 2.0E-07
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 343 571 2.0E-07
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 294 575 2.0E-07
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 290 587 3.0E-07
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 311 571 4.0E-07
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 292 575 5.0E-07
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 343 557 5.0E-07
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 346 509 8.0E-07
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 267 484 8.0E-07
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 334 578 8.0E-07
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 340 490 1.0E-06
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 273 511 2.0E-06
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 348 576 3.0E-06
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 290 509 3.0E-06
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 348 576 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7735
MQTLLMVVALSVVYGVYYYLSNLLHRISEAKRSGFNYVVVPCDPVALPWQLTHSIWVRIIKLFPKRWWEQWLDLM
IPDMPFHTGFENFKRHGEAFLIVSPFSMMLELANAETIRYVAMHREQFPKWTASYGILRQFGENVLTSEGQVWRT
HRKVTSASFNERNAALVFREAILQTQGMMRTWTGPEGVRTEPLRTIEQDTMRLALNIIGYVGFGLRLLWPGQSVA
PNSDPKLVKYGSLEAPAGHKLSFIDTMASVMDNILLLLLMPKWLLHLWPAKRTKLASMAYLDYIKYMDELMEDKI
EEARKGDHAEEGMDLMGHLARTSYGTGGGQRDEAEGKQRPVVLTRDEIIGNAFIMFVAGHETTANTLHFTLVQLA
TNPSAQRKLQRDIDELVGDSEPSSWDYDNLVGPMTASMVGACMYETLRLIPPAAELPKQVSRTQDEPIPMDGRKY
VVPKGTVVSLVGVSVHQNPRYWPHAESRIRRGENDLRDFRPERWFQKASAAGIAGSGSGSGSGSEDIEDYGGYSG
PDTNAQLFRPTRGAYIPFSDGARSCLGRRIAQVEIIAALTVLFRDFSLELAVDDWASQAELATMSRADQRRVYRM
AQDNSRYVMSQASSLITLKLHGEKHVPVRLVRRGEERFVNWAEDY*
Coding >OphauB2|7735
ATGCAGACCTTGTTGATGGTTGTCGCTCTCTCCGTCGTCTATGGCGTCTACTACTACCTGTCCAACCTGCTGCAC
AGGATTTCCGAGGCCAAACGCAGCGGTTTCAACTATGTCGTTGTTCCCTGCGATCCCGTCGCCTTGCCGTGGCAA
CTGACGCATAGCATCTGGGTGCGAATCATCAAGCTGTTTCCCAAGAGGTGGTGGGAGCAATGGCTAGACCTCATG
ATTCCCGACATGCCCTTTCATACGGGCTTTGAAAACTTTAAGCGGCATGGCGAAGCCTTTCTCATTGTCTCTCCC
TTTTCCATGATGCTGGAGCTGGCCAATGCCGAGACTATTCGATATGTGGCGATGCACCGTGAGCAGTTTCCCAAG
TGGACGGCGTCGTACGGCATCTTGCGCCAGTTTGGCGAAAATGTCTTGACGTCGGAGGGCCAGGTGTGGCGCACG
CACCGCAAAGTCACGTCGGCCTCGTTTAACGAGCGCAATGCGGCGCTTGTCTTTCGCGAGGCCATTTTGCAGACC
CAAGGCATGATGCGCACATGGACGGGACCCGAGGGCGTTCGCACCGAGCCCTTGCGCACCATTGAGCAGGACACG
ATGCGGCTGGCGCTCAATATCATTGGATACGTTGGCTTTGGCCTGCGGCTGCTCTGGCCCGGGCAGTCGGTGGCG
CCAAACTCGGACCCCAAGCTGGTCAAGTACGGCTCGCTAGAGGCGCCGGCCGGGCACAAGCTGAGCTTCATCGAC
ACCATGGCGAGCGTCATGGACAACATTTTGCTGCTGCTGCTCATGCCCAAGTGGCTGCTGCACCTGTGGCCGGCC
AAGCGCACCAAGCTGGCGTCAATGGCGTATCTCGACTACATCAAGTACATGGACGAGCTCATGGAGGACAAGATT
GAGGAGGCGCGCAAGGGCGACCACGCCGAGGAGGGCATGGACCTCATGGGCCATCTTGCGCGCACGTCGTATGGG
ACAGGTGGCGGGCAGCGGGACGAGGCAGAAGGCAAGCAGCGGCCGGTTGTGCTGACGCGTGACGAAATCATTGGC
AATGCCTTCATCATGTTTGTGGCGGGACACGAGACGACGGCCAACACGCTGCACTTTACGCTGGTGCAGCTGGCA
ACGAACCCGTCTGCGCAACGGAAGCTGCAGCGCGACATTGACGAGCTGGTGGGCGACTCGGAGCCCAGCTCGTGG
GACTATGACAATCTTGTTGGCCCAATGACGGCCAGCATGGTGGGCGCGTGCATGTACGAGACGCTGCGCCTTATC
CCGCCCGCAGCTGAGCTGCCCAAGCAGGTGTCGCGGACGCAAGACGAGCCGATTCCCATGGACGGGCGCAAGTAC
GTGGTGCCCAAGGGCACTGTGGTGTCGCTGGTGGGCGTGTCGGTGCACCAGAACCCGCGCTATTGGCCCCATGCA
GAGAGTCGGATCCGACGAGGCGAAAACGACTTGCGAGACTTTAGACCGGAGCGCTGGTTCCAGAAGGCTTCGGCG
GCAGGCATTGCAGGCAGCGGCAGTGGCAGCGGCAGCGGCAGCGAGGACATTGAAGACTATGGCGGCTACTCGGGG
CCCGACACGAATGCGCAGCTCTTTCGGCCAACACGGGGCGCGTATATTCCCTTTAGCGACGGAGCTCGGTCGTGT
CTGGGACGGCGCATCGCACAGGTGGAAATCATTGCCGCGCTGACGGTGCTGTTTCGCGACTTTAGCCTCGAGCTG
GCGGTTGACGACTGGGCCAGCCAGGCCGAGCTGGCCACCATGTCGCGGGCGGATCAGCGCCGGGTCTACAGGATG
GCGCAGGACAATAGCCGGTACGTCATGTCACAGGCGTCGAGTCTGATTACCCTCAAGTTGCACGGCGAGAAGCAC
GTGCCGGTGCGGCTGGTGCGGCGGGGCGAGGAGCGCTTTGTCAACTGGGCGGAGGATTATTGA
Transcript >OphauB2|7735
ATGCAGACCTTGTTGATGGTTGTCGCTCTCTCCGTCGTCTATGGCGTCTACTACTACCTGTCCAACCTGCTGCAC
AGGATTTCCGAGGCCAAACGCAGCGGTTTCAACTATGTCGTTGTTCCCTGCGATCCCGTCGCCTTGCCGTGGCAA
CTGACGCATAGCATCTGGGTGCGAATCATCAAGCTGTTTCCCAAGAGGTGGTGGGAGCAATGGCTAGACCTCATG
ATTCCCGACATGCCCTTTCATACGGGCTTTGAAAACTTTAAGCGGCATGGCGAAGCCTTTCTCATTGTCTCTCCC
TTTTCCATGATGCTGGAGCTGGCCAATGCCGAGACTATTCGATATGTGGCGATGCACCGTGAGCAGTTTCCCAAG
TGGACGGCGTCGTACGGCATCTTGCGCCAGTTTGGCGAAAATGTCTTGACGTCGGAGGGCCAGGTGTGGCGCACG
CACCGCAAAGTCACGTCGGCCTCGTTTAACGAGCGCAATGCGGCGCTTGTCTTTCGCGAGGCCATTTTGCAGACC
CAAGGCATGATGCGCACATGGACGGGACCCGAGGGCGTTCGCACCGAGCCCTTGCGCACCATTGAGCAGGACACG
ATGCGGCTGGCGCTCAATATCATTGGATACGTTGGCTTTGGCCTGCGGCTGCTCTGGCCCGGGCAGTCGGTGGCG
CCAAACTCGGACCCCAAGCTGGTCAAGTACGGCTCGCTAGAGGCGCCGGCCGGGCACAAGCTGAGCTTCATCGAC
ACCATGGCGAGCGTCATGGACAACATTTTGCTGCTGCTGCTCATGCCCAAGTGGCTGCTGCACCTGTGGCCGGCC
AAGCGCACCAAGCTGGCGTCAATGGCGTATCTCGACTACATCAAGTACATGGACGAGCTCATGGAGGACAAGATT
GAGGAGGCGCGCAAGGGCGACCACGCCGAGGAGGGCATGGACCTCATGGGCCATCTTGCGCGCACGTCGTATGGG
ACAGGTGGCGGGCAGCGGGACGAGGCAGAAGGCAAGCAGCGGCCGGTTGTGCTGACGCGTGACGAAATCATTGGC
AATGCCTTCATCATGTTTGTGGCGGGACACGAGACGACGGCCAACACGCTGCACTTTACGCTGGTGCAGCTGGCA
ACGAACCCGTCTGCGCAACGGAAGCTGCAGCGCGACATTGACGAGCTGGTGGGCGACTCGGAGCCCAGCTCGTGG
GACTATGACAATCTTGTTGGCCCAATGACGGCCAGCATGGTGGGCGCGTGCATGTACGAGACGCTGCGCCTTATC
CCGCCCGCAGCTGAGCTGCCCAAGCAGGTGTCGCGGACGCAAGACGAGCCGATTCCCATGGACGGGCGCAAGTAC
GTGGTGCCCAAGGGCACTGTGGTGTCGCTGGTGGGCGTGTCGGTGCACCAGAACCCGCGCTATTGGCCCCATGCA
GAGAGTCGGATCCGACGAGGCGAAAACGACTTGCGAGACTTTAGACCGGAGCGCTGGTTCCAGAAGGCTTCGGCG
GCAGGCATTGCAGGCAGCGGCAGTGGCAGCGGCAGCGGCAGCGAGGACATTGAAGACTATGGCGGCTACTCGGGG
CCCGACACGAATGCGCAGCTCTTTCGGCCAACACGGGGCGCGTATATTCCCTTTAGCGACGGAGCTCGGTCGTGT
CTGGGACGGCGCATCGCACAGGTGGAAATCATTGCCGCGCTGACGGTGCTGTTTCGCGACTTTAGCCTCGAGCTG
GCGGTTGACGACTGGGCCAGCCAGGCCGAGCTGGCCACCATGTCGCGGGCGGATCAGCGCCGGGTCTACAGGATG
GCGCAGGACAATAGCCGGTACGTCATGTCACAGGCGTCGAGTCTGATTACCCTCAAGTTGCACGGCGAGAAGCAC
GTGCCGGTGCGGCTGGTGCGGCGGGGCGAGGAGCGCTTTGTCAACTGGGCGGAGGATTATTGA
Gene >OphauB2|7735
ATGCAGACCTTGTTGATGGTTGTCGCTCTCTCCGTCGTCTATGGCGTCTACTACTACCTGTCCAACCTGCTGCAC
AGGATTTCCGAGGCCAAACGCAGCGGTTTCAACTATGTCGTTGTTCGTGAGTCTTGTCCCTGCCCCGACACGGCG
AGCCTGTTGTGCTAACGCTCTCTGGAGCCTGCGATCCCGTCGCCTTGCCGTGGCAACTGACGCATAGCATCTGGG
TGCGAATCATCAAGCTGTTTCCCAAGAGGTGGTGGGAGCAATGGCTAGAGTATGGCTGTCCTCTTTCCCCCCCTG
AAGCGACAAGAGTGCGCCCTGTGACTAACGGCTATTGCTGCCAATGGCCAGCCTCATGATTCCCGACATGCCCTT
TCATACGGGCTTTGAAAACTTTAAGCGGCATGGCGAAGCCTTTCTCATTGTCTCTCCCTTTTCCATGATGCTGGA
GCTGGCCAATGCCGAGACTATTCGATATGTGGCGATGCACCGTGAGCAGTTTCCCAAGTGGACGGCGTCGTACGG
CATCTTGCGCCAGTTTGGCGAAAATGTCTTGACGTCGGAGGGCCAGGTGTGGCGCACGCACCGCAAAGTCACGTC
GGCCTCGTTTAACGAGCGCAATGCGGCGCTTGTCTTTCGCGAGGCCATTTTGCAGACCCAAGGCATGATGCGCAC
ATGGACGGGACCCGAGGGCGTTCGCACCGAGCCCTTGCGCACCATTGAGCAGGACACGATGCGGCTGGCGCTCAA
TATCATTGGATACGTTGGCTTTGGCCTGCGGCTGCTCTGGCCCGGGCAGTCGGTGGCGCCAAACTCGGACCCCAA
GCTGGTCAAGTACGGCTCGCTAGAGGCGCCGGCCGGGCACAAGCTGAGCTTCATCGACACCATGGCGAGCGTCAT
GGACAACATTTTGCTGCTGCTGCTCATGCCCAAGTGGCTGCTGCACCTGTGGCCGGCCAAGCGCACCAAGCTGGC
GTCAATGGCGTATCTCGACTACATCAAGTACATGGACGAGCTCATGGAGGACAAGATTGAGGAGGCGCGCAAGGG
CGACCACGCCGAGGAGGGCATGGACCTCATGGGCCATCTTGCGCGCACGTCGTATGGGACAGGTGGCGGGCAGCG
GGACGAGGCAGAAGGCAAGCAGCGGCCGGTTGTGCTGACGCGTGACGAAATCATTGGCAATGCCTTCATCATGTT
TGTGGCGGGACACGAGACGACGGCCAACACGCTGCACTTTACGCTGGTGCAGCTGGCAACGAACCCGTCTGCGCA
ACGGAAGCTGCAGCGCGACATTGACGAGCTGGTGGGCGACTCGGAGCCCAGCTCGTGGGACTATGACAATCTTGT
TGGCCCAATGACGGCCAGCATGGTGGGCGCGTGCATGTACGAGACGCTGCGCCTTATCCCGCCCGCAGCTGAGCT
GCCCAAGCAGGTGTCGCGGACGCAAGACGAGCCGATTCCCATGGACGGGCGCAAGTACGTGGTGCCCAAGGGCAC
TGTGGTGTCGCTGGTGGGCGTGTCGGTGCACCAGAACCCGCGCTATTGGCCCCATGCAGAGAGTCGGATCCGACG
AGGCGAAAACGACTTGCGAGACTTTAGACCGGAGCGCTGGTTCCAGAAGGCTTCGGCGGCAGGCATTGCAGGCAG
CGGCAGTGGCAGCGGCAGCGGCAGCGAGGACATTGAAGACTATGGCGGCTACTCGGGGCCCGACACGAATGCGCA
GCTCTTTCGGCCAACACGGGGCGCGTATATTCCCTTTAGCGACGGAGCTCGGTCGTGTCTGGGACGGCGCATCGC
ACAGGTGGAAATCATTGCCGCGCTGACGGTGCTGTTTCGCGACTTTAGCCTCGAGCTGGCGGTTGACGACTGGGC
CAGCCAGGCCGAGCTGGCCACCATGTCGCGGGCGGATCAGCGCCGGGTCTACAGGATGGCGCAGGACAATAGCCG
GTACGTCATGTCACAGGCGTCGAGTCTGATTACCCTCAAGTTGCACGGCGAGAAGCACGTGCCGGTGCGGCTGGT
GCGGCGGGGCGAGGAGCGCTTTGTCAACTGGGCGGAGGATTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail