Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7732
Gene name
LocationContig_87:40239..41928
Strand+
Gene length (bp)1689
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.3E-44 80 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 9 483 1.0E-33
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 75 495 1.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 72 253 2.0E-27
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 35 504 3.0E-26
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 34 494 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 9 483 1.0E-33
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 75 495 1.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 72 253 2.0E-27
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 35 504 3.0E-26
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 34 494 8.0E-26
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 72 256 1.0E-24
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 80 495 2.0E-22
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 9 466 3.0E-21
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 71 466 4.0E-20
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 76 494 8.0E-20
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 76 494 1.0E-19
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 68 466 5.0E-19
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 4 466 8.0E-18
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 71 496 9.0E-18
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 64 497 1.0E-17
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 71 496 2.0E-17
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 15 465 2.0E-17
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 71 466 4.0E-17
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 71 466 8.0E-17
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 12 499 2.0E-16
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 88 497 2.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 324 497 1.0E-15
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 88 484 1.0E-15
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 57 466 8.0E-15
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 100 499 1.0E-14
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 74 352 1.0E-14
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 13 466 6.0E-14
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 57 531 6.0E-14
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 84 444 7.0E-14
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 72 444 3.0E-13
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 324 497 6.0E-13
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 71 269 3.0E-12
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 123 252 3.0E-12
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 64 370 3.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 123 252 3.0E-12
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 56 444 6.0E-12
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 100 392 1.0E-11
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 70 253 2.0E-11
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 71 273 2.0E-10
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 84 231 3.0E-10
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 82 289 8.0E-10
sp|P39386|MDTM_ECOLI Multidrug resistance protein MdtM OS=Escherichia coli (strain K12) GN=mdtM PE=1 SV=1 84 271 8.0E-10
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 84 271 2.0E-09
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 56 502 3.0E-09
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 67 277 8.0E-09
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 83 231 1.0E-08
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 67 231 2.0E-08
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 99 228 2.0E-08
sp|O31577|YFHI_BACSU Uncharacterized MFS-type transporter YfhI OS=Bacillus subtilis (strain 168) GN=yfhI PE=3 SV=1 75 263 6.0E-08
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 82 289 6.0E-08
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 88 274 9.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 84 232 1.0E-07
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 32 251 2.0E-07
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 78 275 2.0E-07
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 78 275 2.0E-07
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 78 275 2.0E-07
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 78 275 2.0E-07
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 6 251 2.0E-07
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 78 275 3.0E-07
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 78 275 3.0E-07
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 78 275 3.0E-07
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 78 275 3.0E-07
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 78 275 3.0E-07
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 68 256 3.0E-07
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 78 275 4.0E-07
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 78 275 4.0E-07
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 78 275 4.0E-07
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 78 252 4.0E-07
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 78 252 4.0E-07
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 78 252 4.0E-07
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 78 252 4.0E-07
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 78 252 4.0E-07
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 78 252 5.0E-07
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 78 252 5.0E-07
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 78 252 5.0E-07
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 78 252 6.0E-07
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 78 252 6.0E-07
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 78 252 6.0E-07
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 78 252 6.0E-07
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 78 252 7.0E-07
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 78 252 7.0E-07
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 78 252 7.0E-07
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 78 240 8.0E-07
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 78 252 9.0E-07
sp|Q7CP73|MDTM_SALTY Multidrug resistance protein MdtM OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtM PE=3 SV=1 99 280 1.0E-06
sp|Q8XFG0|MDTM_SALTI Multidrug resistance protein MdtM OS=Salmonella typhi GN=mdtM PE=3 SV=1 99 280 1.0E-06
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 78 275 1.0E-06
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 129 256 2.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 46 247 2.0E-06
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 46 247 2.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 65 259 2.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 65 259 2.0E-06
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 69 248 2.0E-06
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 3 248 3.0E-06
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 78 243 4.0E-06
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 78 252 6.0E-06
sp|Q323U7|MDFA_SHIBS Multidrug transporter MdfA OS=Shigella boydii serotype 4 (strain Sb227) GN=mdfA PE=3 SV=2 130 252 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 111 133 22
3 140 162 22
4 166 188 22
5 200 222 22
6 227 249 22
7 284 306 22
8 328 350 22
9 371 393 22
10 397 419 22
11 440 459 19
12 464 486 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7732
MAPSSESGHVVTSDSASIKAAPPRHTAIGVEAFRSASHASGPDAFPAGQSDSTPASDDQDNGLYDGLSRTRKHVI
VTVCAFCAFLAPMSSTSVLAATPEVATEFHTTGSIINASNAVYMFFMGLSPIFWGPISEVWGRRPVLIGTAGLFL
LLSVATALTPNLVAFFIFRAASAFEGTTFILLGAACIGDIYPPTERGTAIGWFLSGTLIGPALGPFIGGIIVTYS
SWRTIFWLQTGLAGLGFLGLVFLVPETIHHKTISDLANCSSREKRGAVLRMINPIRPLALFRYLNQFLVAFGSSA
LVWNMYSLLTPIRYVLNPRFHLDSPLLSGLFYLAPGCGYLVGTLMGGRWADRTVRVWIDKRGGVRVPEDRLRSAV
PFMGLLMPASVLIYGWSVDRAVGGIPVPVIFLFVQGVGQLFCFPSLNTYCLDVMPGHGAQVTAANYFFRYLAGCL
GTAVVLPAVQGMGVGWFETLSAALLVVASLGILATIRWGESWRRRTDGRLDKSPVATRVEHEASEQAPAQEVAEK
RITTTP*
Coding >OphauB2|7732
ATGGCTCCCAGCTCGGAGAGCGGCCACGTCGTCACCAGCGACAGCGCCAGCATCAAGGCGGCGCCGCCTCGGCAC
ACAGCCATTGGCGTCGAGGCGTTCCGGTCCGCCTCGCACGCGTCGGGCCCCGATGCCTTTCCCGCCGGCCAGAGC
GACTCGACGCCCGCAAGCGACGACCAGGACAACGGCTTGTATGACGGGCTGAGTCGCACGCGCAAACACGTCATT
GTCACCGTCTGTGCCTTTTGCGCCTTTCTCGCGCCCATGTCGAGCACCAGCGTTTTGGCTGCCACGCCCGAAGTG
GCGACCGAGTTTCACACAACGGGCTCCATCATTAATGCCAGCAATGCCGTCTACATGTTCTTTATGGGTCTCTCG
CCCATCTTCTGGGGGCCTATTAGCGAGGTCTGGGGCCGTCGTCCCGTCCTCATTGGCACCGCCGGCCTCTTTCTT
CTCTTGAGCGTCGCCACGGCGCTGACGCCCAACCTCGTCGCCTTTTTCATCTTTCGCGCCGCTTCGGCCTTTGAG
GGAACAACTTTTATTCTCTTGGGCGCTGCCTGCATTGGCGACATCTATCCCCCGACTGAGCGAGGCACCGCCATT
GGATGGTTTCTGTCGGGCACTCTCATCGGTCCCGCTCTAGGCCCCTTTATCGGCGGCATCATTGTGACATATTCT
TCATGGCGCACCATCTTTTGGCTGCAGACGGGACTTGCTGGTCTTGGGTTTCTGGGCCTTGTGTTTCTGGTGCCC
GAGACTATCCACCACAAGACCATTTCCGACTTGGCCAACTGCTCGAGCCGGGAAAAGAGAGGGGCTGTGCTCCGC
ATGATTAACCCTATACGGCCACTGGCCCTGTTTCGTTACCTGAACCAATTTCTCGTGGCCTTTGGCAGCTCAGCG
CTCGTGTGGAACATGTATAGTCTTTTGACGCCCATCCGCTACGTCTTGAATCCTCGCTTCCATCTCGATTCGCCG
CTGCTGTCAGGCCTCTTTTACCTTGCGCCCGGCTGCGGCTACCTCGTCGGCACCTTGATGGGTGGTCGCTGGGCC
GATCGGACGGTGCGCGTCTGGATAGATAAGCGCGGCGGCGTACGCGTGCCCGAGGACCGGCTGCGGTCGGCAGTG
CCCTTTATGGGGCTGCTCATGCCGGCCTCGGTCCTCATCTATGGCTGGTCTGTGGACCGGGCTGTGGGGGGCATT
CCCGTGCCCGTCATCTTCCTCTTTGTGCAGGGCGTCGGCCAACTCTTTTGCTTCCCATCGCTAAACACCTACTGC
CTCGACGTGATGCCAGGTCATGGGGCGCAGGTGACGGCAGCGAATTACTTCTTTCGCTATCTTGCTGGCTGCTTG
GGCACGGCTGTAGTGCTGCCGGCCGTACAGGGCATGGGTGTTGGGTGGTTTGAGACGCTATCAGCGGCACTGCTA
GTCGTTGCGTCGCTGGGCATCCTGGCAACGATCCGGTGGGGTGAAAGCTGGAGAAGGCGCACTGATGGGCGGCTA
GACAAGTCGCCTGTGGCTACTCGAGTAGAGCACGAGGCTTCCGAGCAGGCCCCGGCACAAGAGGTGGCGGAAAAA
CGAATAACTACTACTCCCTAG
Transcript >OphauB2|7732
ATGGCTCCCAGCTCGGAGAGCGGCCACGTCGTCACCAGCGACAGCGCCAGCATCAAGGCGGCGCCGCCTCGGCAC
ACAGCCATTGGCGTCGAGGCGTTCCGGTCCGCCTCGCACGCGTCGGGCCCCGATGCCTTTCCCGCCGGCCAGAGC
GACTCGACGCCCGCAAGCGACGACCAGGACAACGGCTTGTATGACGGGCTGAGTCGCACGCGCAAACACGTCATT
GTCACCGTCTGTGCCTTTTGCGCCTTTCTCGCGCCCATGTCGAGCACCAGCGTTTTGGCTGCCACGCCCGAAGTG
GCGACCGAGTTTCACACAACGGGCTCCATCATTAATGCCAGCAATGCCGTCTACATGTTCTTTATGGGTCTCTCG
CCCATCTTCTGGGGGCCTATTAGCGAGGTCTGGGGCCGTCGTCCCGTCCTCATTGGCACCGCCGGCCTCTTTCTT
CTCTTGAGCGTCGCCACGGCGCTGACGCCCAACCTCGTCGCCTTTTTCATCTTTCGCGCCGCTTCGGCCTTTGAG
GGAACAACTTTTATTCTCTTGGGCGCTGCCTGCATTGGCGACATCTATCCCCCGACTGAGCGAGGCACCGCCATT
GGATGGTTTCTGTCGGGCACTCTCATCGGTCCCGCTCTAGGCCCCTTTATCGGCGGCATCATTGTGACATATTCT
TCATGGCGCACCATCTTTTGGCTGCAGACGGGACTTGCTGGTCTTGGGTTTCTGGGCCTTGTGTTTCTGGTGCCC
GAGACTATCCACCACAAGACCATTTCCGACTTGGCCAACTGCTCGAGCCGGGAAAAGAGAGGGGCTGTGCTCCGC
ATGATTAACCCTATACGGCCACTGGCCCTGTTTCGTTACCTGAACCAATTTCTCGTGGCCTTTGGCAGCTCAGCG
CTCGTGTGGAACATGTATAGTCTTTTGACGCCCATCCGCTACGTCTTGAATCCTCGCTTCCATCTCGATTCGCCG
CTGCTGTCAGGCCTCTTTTACCTTGCGCCCGGCTGCGGCTACCTCGTCGGCACCTTGATGGGTGGTCGCTGGGCC
GATCGGACGGTGCGCGTCTGGATAGATAAGCGCGGCGGCGTACGCGTGCCCGAGGACCGGCTGCGGTCGGCAGTG
CCCTTTATGGGGCTGCTCATGCCGGCCTCGGTCCTCATCTATGGCTGGTCTGTGGACCGGGCTGTGGGGGGCATT
CCCGTGCCCGTCATCTTCCTCTTTGTGCAGGGCGTCGGCCAACTCTTTTGCTTCCCATCGCTAAACACCTACTGC
CTCGACGTGATGCCAGGTCATGGGGCGCAGGTGACGGCAGCGAATTACTTCTTTCGCTATCTTGCTGGCTGCTTG
GGCACGGCTGTAGTGCTGCCGGCCGTACAGGGCATGGGTGTTGGGTGGTTTGAGACGCTATCAGCGGCACTGCTA
GTCGTTGCGTCGCTGGGCATCCTGGCAACGATCCGGTGGGGTGAAAGCTGGAGAAGGCGCACTGATGGGCGGCTA
GACAAGTCGCCTGTGGCTACTCGAGTAGAGCACGAGGCTTCCGAGCAGGCCCCGGCACAAGAGGTGGCGGAAAAA
CGAATAACTACTACTCCCTAG
Gene >OphauB2|7732
ATGGCTCCCAGCTCGGAGAGCGGCCACGTCGTCACCAGCGACAGCGCCAGCATCAAGGCGGCGCCGCCTCGGCAC
ACAGCCATTGGCGTCGAGGCGTTCCGGTCCGCCTCGCACGCGTCGGGCCCCGATGCCTTTCCCGCCGGCCAGAGC
GACTCGACGCCCGCAAGCGACGACCAGGACAACGGCTTGTATGACGGGCTGAGTCGCACGCGCAAACACGTCATT
GTCACCGTCTGTGCCTTTTGCGCCTTTCTCGCGCCCATGTCGAGCACCAGCGTTTTGGCTGCCACGCCCGAAGTG
GCGACCGAGTTTCACACAACGGGCTCCATCATTAATGCCAGCAATGCCGTCTACATGTTCTTTATGGGTCTCTCG
CCCATCTTCTGGGGGCCTATTAGCGAGGTCTGGGGCCGTCGTCCCGTCCTCATTGGCACCGCCGGCCTCTTTCTT
CTCTTGAGCGTCGCCACGGCGCTGACGCCCAACCTCGTCGCCTTTTTCATCTTTCGCGCCGCTTCGGCCTTTGAG
GGAACAACTTTTATTCTCTTGGGCGCTGCCTGCATTGGGTTTGTTGCGCCTTTTTGGTTTTTTCCCCTCTAGTCT
CGAGTCTTTTTGTTGTCTAGTTACCAAGTCGTTGTTAAGCTGACTCTGGCGCACAGCGACATCTATCCCCCGACT
GAGCGAGGCACCGCCATTGGATGGTTTCTGTCGGGCACTCTCATCGGTCCCGCTCTAGGCCCCTTTATCGGCGGC
ATCATTGTGACATATTCTTCATGGCGCACCATCTTTTGGCTGCAGACGGGACTTGCTGGTCTTGGGTTTCTGGGC
CTTGTGTTTCTGGTGCCCGAGACTATCCACCACAAGACCATTTCCGACTTGGCCAACTGCTCGAGCCGGGAAAAG
AGAGGGGCTGTGCTCCGCATGATTAACCCTATACGGCCACTGGCCCTGTTTCGTTACCTGAACCAATTTCTCGTG
GCCTTTGGCAGCTCAGCGCTCGTGTGGAACATGTATAGTCTTTTGACGCCCATCCGCTACGTCTTGAATCCTCGC
TTCCATCTCGATTCGCCGCTGCTGTCAGGCCTCTTTTACCTTGCGCCCGGCTGCGGCTACCTCGTCGGCACCTTG
ATGGGTGGTCGCTGGGCCGATCGGACGGTGCGCGTCTGGATAGATAAGCGCGGCGGCGTACGCGTGCCCGAGGAC
CGGCTGCGGTCGGCAGTGCCCTTTATGGGGCTGCTCATGCCGGCCTCGGTCCTCATCTATGGCTGGTCTGTGGAC
CGGGCTGTGGGGGGCATTCCCGTGCCCGTCATCTTCCTCTTTGTGCAGGGCGTCGGCCAACTCTTTTGCTTCCCA
TCGCTAAACACCTACTGCCTCGACGTGATGCCAGGTCATGGGGCGCAGGTGACGGCAGCGAATTACTTCTTTCGC
TATCTTGCTGGCTGCTTGGGCACGGCTGTAGTGCTGCCGGCCGTACAGGGCATGGGTGTTGGGTGGTTTGAGACG
CTATCAGCGGCACTGCTAGTCGTTGCGTCGCTGGGCATCCTGGCAACGATCCGGTGGGGTGAAAGCTGGAGAAGG
CGCACTGATGGGCGGCTAGACAAGTCGCCTGTGGCTACTCGAGTAGAGCACGAGGCTTCCGAGCAGGCCCCGGCA
CAAGAGGTGGCGGAAAAACGAATAACTACTACTCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail