Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7729
Gene name
LocationContig_87:32286..33771
Strand+
Gene length (bp)1485
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16679 CDT1_C DNA replication factor Cdt1 C-terminal domain 1.6E-21 365 465

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2919
Ophiocordyceps australis map64 (Brazil) OphauB2|7729 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00956
Ophiocordyceps camponoti-rufipedis Ophun1|7128
Ophiocordyceps kimflemingae Ophio5|1040

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7729
MARKARTRQQPEPPATQAIDAFVRSSKSNATASPGIAKDKLCSSDLVSRKRKATALACSEQVKGSVSTCSNGDDQ
VEKAATRSKRARRRSGSKLQSVQNPPALLTRRSAPATKGKRVAKAKASHAHSAHGLSKQTPISKARQHNRTVQTK
LQVVIQQRTKRCNKGEDGDGATRRDELPRHLSELVCLNRSFLKAMALHAAHSGHLAPVDTRRLATDVSRSWGKRQ
VTVEDFRRCIAIQGHVPATPSPYIIVDYGHGKVCVELAPGMRHSPADLERLHSQFIDNLHHVATERAASPDTMDI
DDVPLGRLSLSDLPQAAVEDKTPCSANNPLLAKGQRALAHLKSGLAAKQEQEPRRAAHGPLSKLSVLDRIRLKQE
ARNDGSAPAPPTAAELMRKAALERVVDVAATLSMLSMASGNQPRQAFAMNLVVERLRDSLQVPISKDGGAACVRL
IAGEVAPEWIRVVTLGGRDNVVISKAGLPADRVLRGRVDELMTA*
Coding >OphauB2|7729
ATGGCTCGCAAGGCAAGAACTCGTCAGCAGCCGGAGCCTCCTGCCACGCAGGCCATTGATGCCTTTGTTCGCTCC
TCCAAGTCCAATGCGACTGCCAGTCCAGGCATAGCAAAAGACAAACTCTGCAGCTCCGACCTTGTTTCCCGCAAG
AGAAAGGCAACGGCATTGGCTTGCAGCGAACAAGTCAAGGGAAGCGTCTCGACTTGTAGCAATGGCGACGACCAA
GTCGAAAAGGCTGCAACTCGGTCAAAGCGAGCGCGTCGACGGTCTGGCTCAAAGCTGCAATCCGTGCAGAACCCG
CCTGCGCTGCTTACGAGACGCAGCGCCCCTGCCACAAAGGGCAAACGCGTGGCCAAGGCAAAGGCGTCTCACGCT
CACAGTGCCCATGGATTGAGCAAGCAAACGCCCATTTCCAAGGCGCGGCAACACAATCGCACCGTTCAGACCAAG
CTTCAAGTTGTCATTCAGCAGCGGACCAAGCGGTGCAACAAGGGCGAAGACGGAGACGGGGCTACGAGACGAGAT
GAATTGCCTCGCCACTTGTCGGAGCTCGTTTGCCTCAATCGAAGCTTTCTCAAAGCCATGGCTCTGCACGCGGCG
CACTCTGGCCATCTCGCACCCGTCGACACGCGTCGCTTGGCTACAGATGTCTCACGCTCATGGGGGAAGCGGCAG
GTGACGGTGGAGGATTTTCGGCGATGCATTGCTATTCAAGGACATGTGCCAGCCACGCCGTCGCCCTACATTATT
GTCGACTACGGCCATGGCAAGGTTTGCGTCGAGCTGGCGCCGGGTATGCGGCACTCTCCTGCCGACTTGGAGCGT
CTTCACAGCCAGTTTATCGACAATTTGCACCATGTCGCCACGGAGCGGGCAGCTAGCCCCGACACAATGGACATT
GACGACGTGCCTCTTGGACGCTTGTCTCTGTCAGATCTTCCACAAGCAGCCGTTGAGGACAAGACTCCATGCAGC
GCCAACAACCCCTTGCTTGCCAAGGGACAACGGGCTCTGGCACACCTCAAGAGCGGCTTGGCAGCCAAGCAGGAA
CAAGAGCCCCGTCGCGCCGCCCATGGCCCGCTCTCCAAACTCAGTGTCCTGGATCGTATCCGGCTCAAGCAGGAA
GCCCGCAACGACGGGAGCGCGCCAGCACCTCCCACTGCGGCCGAGCTGATGCGCAAGGCAGCTCTAGAACGAGTC
GTTGACGTGGCAGCAACACTATCGATGCTGAGCATGGCGAGCGGAAATCAGCCTCGGCAGGCCTTTGCCATGAAT
CTTGTGGTGGAGCGGCTGCGCGACTCGCTGCAGGTGCCCATTTCCAAGGACGGGGGCGCGGCGTGCGTGCGGCTG
ATTGCGGGCGAGGTGGCGCCCGAATGGATTCGCGTGGTGACGCTGGGCGGACGGGACAATGTCGTCATTTCCAAG
GCTGGGCTGCCGGCAGACAGGGTGTTGCGTGGGCGGGTGGATGAATTGATGACGGCATAG
Transcript >OphauB2|7729
ATGGCTCGCAAGGCAAGAACTCGTCAGCAGCCGGAGCCTCCTGCCACGCAGGCCATTGATGCCTTTGTTCGCTCC
TCCAAGTCCAATGCGACTGCCAGTCCAGGCATAGCAAAAGACAAACTCTGCAGCTCCGACCTTGTTTCCCGCAAG
AGAAAGGCAACGGCATTGGCTTGCAGCGAACAAGTCAAGGGAAGCGTCTCGACTTGTAGCAATGGCGACGACCAA
GTCGAAAAGGCTGCAACTCGGTCAAAGCGAGCGCGTCGACGGTCTGGCTCAAAGCTGCAATCCGTGCAGAACCCG
CCTGCGCTGCTTACGAGACGCAGCGCCCCTGCCACAAAGGGCAAACGCGTGGCCAAGGCAAAGGCGTCTCACGCT
CACAGTGCCCATGGATTGAGCAAGCAAACGCCCATTTCCAAGGCGCGGCAACACAATCGCACCGTTCAGACCAAG
CTTCAAGTTGTCATTCAGCAGCGGACCAAGCGGTGCAACAAGGGCGAAGACGGAGACGGGGCTACGAGACGAGAT
GAATTGCCTCGCCACTTGTCGGAGCTCGTTTGCCTCAATCGAAGCTTTCTCAAAGCCATGGCTCTGCACGCGGCG
CACTCTGGCCATCTCGCACCCGTCGACACGCGTCGCTTGGCTACAGATGTCTCACGCTCATGGGGGAAGCGGCAG
GTGACGGTGGAGGATTTTCGGCGATGCATTGCTATTCAAGGACATGTGCCAGCCACGCCGTCGCCCTACATTATT
GTCGACTACGGCCATGGCAAGGTTTGCGTCGAGCTGGCGCCGGGTATGCGGCACTCTCCTGCCGACTTGGAGCGT
CTTCACAGCCAGTTTATCGACAATTTGCACCATGTCGCCACGGAGCGGGCAGCTAGCCCCGACACAATGGACATT
GACGACGTGCCTCTTGGACGCTTGTCTCTGTCAGATCTTCCACAAGCAGCCGTTGAGGACAAGACTCCATGCAGC
GCCAACAACCCCTTGCTTGCCAAGGGACAACGGGCTCTGGCACACCTCAAGAGCGGCTTGGCAGCCAAGCAGGAA
CAAGAGCCCCGTCGCGCCGCCCATGGCCCGCTCTCCAAACTCAGTGTCCTGGATCGTATCCGGCTCAAGCAGGAA
GCCCGCAACGACGGGAGCGCGCCAGCACCTCCCACTGCGGCCGAGCTGATGCGCAAGGCAGCTCTAGAACGAGTC
GTTGACGTGGCAGCAACACTATCGATGCTGAGCATGGCGAGCGGAAATCAGCCTCGGCAGGCCTTTGCCATGAAT
CTTGTGGTGGAGCGGCTGCGCGACTCGCTGCAGGTGCCCATTTCCAAGGACGGGGGCGCGGCGTGCGTGCGGCTG
ATTGCGGGCGAGGTGGCGCCCGAATGGATTCGCGTGGTGACGCTGGGCGGACGGGACAATGTCGTCATTTCCAAG
GCTGGGCTGCCGGCAGACAGGGTGTTGCGTGGGCGGGTGGATGAATTGATGACGGCATAG
Gene >OphauB2|7729
ATGGCTCGCAAGGCAAGAACTCGTCAGCAGCCGGAGCCTCCTGCCACGCAGGCCATTGATGCCTTTGTTCGCTCC
TCCAAGTCCAATGCGACTGCCAGTCCAGGCATAGCAAAAGACAAACTCTGCAGCTCCGACCTTGTTTCCCGCAAG
AGAAAGGCAACGGCATTGGCTTGCAGCGAACAAGTCAAGGGAAGCGTCTCGACTTGTAGCAATGGCGACGACCAA
GTCGAAAAGGCTGCAACTCGGTCAAAGCGAGCGCGTCGACGGTCTGGCTCAAAGCTGCAATCCGTGCAGAACCCG
CCTGCGCTGCTTACGAGACGCAGCGCCCCTGCCACAAAGGGCAAACGCGTGGCCAAGGCAAAGGCGTCTCACGCT
CACAGTGCCCATGGATTGAGCAAGCAAACGCCCATTTCCAAGGCGCGGCAACACAATCGCACCGTTCAGACCAAG
CTTCAAGTTGTCATTCAGCAGCGGACCAAGCGGTGCAACAAGGGCGAAGACGGAGACGGGGCTACGAGACGAGAT
GAATTGCCTCGCCACTTGTCGGAGCTCGTTTGCCTCAATCGAAGCTTTCTCAAAGCCATGGCTCTGCACGCGGCG
CACTCTGGCCATCTCGCACCCGTCGACACGCGTCGCTTGGCTACAGATGTCTCACGCTCATGGGGGAAGCGGCAG
GTGACGGTGGAGGATTTTCGGCGATGCATTGCTATTCAAGGACATGTGCCAGCCACGCCGTCGCCCTACATTATT
GTCGACTACGGCCATGGCAAGGTTTGCGTCGAGCTGGCGCCGGGTATGCGGCACTCTCCTGCCGACTTGGAGCGT
CTTCACAGCCAGTTTATCGACAATTTGCACCATGTCGCCACGGAGCGGGCAGCTAGCCCCGACACAATGGACATT
GACGACGTGCCTCTTGGACGCTTGTCTCTGTCAGATCTTCCACAAGCAGCCGTTGAGGACAAGACTCCATGCAGC
GCCAACAACCCCTTGCTTGCCAAGGGACAACGGGCTCTGGCACACCTCAAGAGCGGCTTGGCAGCCAAGCAGGAA
CAAGAGCCCCGTCGCGCCGCCCATGGCCCGCTCTCCAAACTCAGTGTCCTGGATCGTATCCGGCTCAAGCAGGAA
GCCCGCAACGACGGGAGCGCGCCAGCACCTCCCACTGCGGCCGAGCTGATGCGCAAGGCAGCTCTAGAACGAGTC
GTTGACGTGGCAGCAACACTATCGATGCTGAGCATGGCGAGCGGAAATCAGCCTCGGCAGGCCTTTGCCATGAAT
CTTGTGGTGGAGCGGCTGCGCGACTCGCTGCAGGTGCCCATTTCCAAGGACGGGGGCGCGGCGTGCGTGCGGCTG
ATTGCGGGCGAGGTGGCGCCCGAATGGATTCGCGTGGTGACGCTGGGCGGACGGGACAATGTCGTCATTTCCAAG
GCTGGGCTGCCGGCAGACAGGGTGTTGCGTGGGCGGGTGGATGAATTGATGACGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail