Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7717
Gene name
LocationContig_86:78328..78841
Strand-
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2289
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|7716
Ophiocordyceps australis map64 (Brazil) OphauB2|7717 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3027
Ophiocordyceps subramaniannii Hirsu2|8283

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7717
MRTTSLLLGAAASVSAIIGGEVYDVMLSDTTFFCADNCLFGGGFFQQNGPWCLASEVVALVDKDPAKDQLRFLAC
NGTANPQVWRERALKPSDRQPEECWISEVDPEFPQLRCSSNRSGGSGGKNTKPVAWSELQKMLETATAGAKEKEA
APKKAAPQPPLPGEDRWVWA*
Coding >OphauB2|7717
ATGCGCACCACATCTCTCCTCCTCGGTGCCGCCGCCAGCGTCAGCGCCATCATCGGCGGCGAAGTCTACGACGTA
ATGCTCTCCGACACCACCTTTTTCTGCGCCGACAACTGCCTCTTTGGCGGCGGCTTTTTCCAACAAAACGGCCCC
TGGTGTCTCGCCAGCGAAGTCGTTGCCCTCGTCGACAAGGACCCCGCCAAGGACCAGCTCCGCTTCCTCGCCTGC
AACGGCACGGCAAACCCCCAAGTTTGGCGTGAGCGCGCCCTCAAGCCTTCAGACCGCCAGCCCGAGGAGTGTTGG
ATCTCGGAAGTCGATCCCGAGTTTCCTCAGCTGAGGTGCTCGAGCAACAGGAGCGGGGGCAGCGGCGGCAAGAAT
ACCAAGCCGGTGGCGTGGTCGGAGCTGCAAAAGATGCTGGAAACGGCCACGGCTGGCGCCAAGGAAAAGGAGGCG
GCGCCCAAGAAGGCGGCGCCTCAGCCACCGCTGCCGGGTGAGGACCGTTGGGTGTGGGCTTGA
Transcript >OphauB2|7717
ATGCGCACCACATCTCTCCTCCTCGGTGCCGCCGCCAGCGTCAGCGCCATCATCGGCGGCGAAGTCTACGACGTA
ATGCTCTCCGACACCACCTTTTTCTGCGCCGACAACTGCCTCTTTGGCGGCGGCTTTTTCCAACAAAACGGCCCC
TGGTGTCTCGCCAGCGAAGTCGTTGCCCTCGTCGACAAGGACCCCGCCAAGGACCAGCTCCGCTTCCTCGCCTGC
AACGGCACGGCAAACCCCCAAGTTTGGCGTGAGCGCGCCCTCAAGCCTTCAGACCGCCAGCCCGAGGAGTGTTGG
ATCTCGGAAGTCGATCCCGAGTTTCCTCAGCTGAGGTGCTCGAGCAACAGGAGCGGGGGCAGCGGCGGCAAGAAT
ACCAAGCCGGTGGCGTGGTCGGAGCTGCAAAAGATGCTGGAAACGGCCACGGCTGGCGCCAAGGAAAAGGAGGCG
GCGCCCAAGAAGGCGGCGCCTCAGCCACCGCTGCCGGGTGAGGACCGTTGGGTGTGGGCTTGA
Gene >OphauB2|7717
ATGCGCACCACATCTCTCCTCCTCGGTGCCGCCGCCAGCGTCAGCGCCATCATCGGCGGCGAAGTCTACGACGTA
ATGCTCTCCGACACCACCTTTTTCTGCGCCGACAACTGCCTCTTTGGCGGCGGCTTTTTCCAACAAAACGGCCCC
TGGTGTCTCGCCAGCGAAGTCGTTGCCCTCGTCGACAAGGACCCCGCCAAGGACCAGCTCCGCTTCCTCGCCTGC
AACGGCACGGCAAACCCCCAAGTTTGGCGTGAGCGCGCCCTCAAGCCTTCAGACCGCCAGCCCGAGGAGTGTTGG
ATCTCGGAAGTCGATCCCGAGTTTCCTCAGCTGAGGTGCTCGAGCAACAGGAGCGGGGGCAGCGGCGGCAAGAAT
ACCAAGCCGGTGGCGTGGTCGGAGCTGCAAAAGATGCTGGAAACGGCCACGGCTGGCGCCAAGGAAAAGGAGGCG
GCGCCCAAGAAGGCGGCGCCTCAGCCACCGCTGCCGGGTGAGGACCGTTGGGTGTGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail