Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7711
Gene name
LocationContig_86:66171..67592
Strand+
Gene length (bp)1421
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 9.1E-32 6 204
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.5E-19 15 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 256 1.0E-40
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 4 297 6.0E-29
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 5 211 5.0E-14
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 5 211 5.0E-14
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 4 245 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 256 1.0E-40
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 4 297 6.0E-29
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 5 211 5.0E-14
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 5 211 5.0E-14
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 4 245 5.0E-14
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 51 198 9.0E-14
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 5 211 5.0E-13
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 5 211 5.0E-13
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 5 211 5.0E-13
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 5 211 5.0E-13
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 5 211 5.0E-13
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 3 249 7.0E-13
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 5 211 8.0E-13
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 4 212 3.0E-12
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 3 199 3.0E-12
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 5 199 5.0E-12
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 3 197 6.0E-12
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 3 197 6.0E-12
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 7 259 6.0E-12
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 3 247 1.0E-11
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 3 182 2.0E-11
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 3 199 2.0E-11
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 3 182 2.0E-11
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 1 228 2.0E-11
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 3 182 2.0E-11
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 5 240 5.0E-11
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 5 182 6.0E-11
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 3 183 6.0E-11
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 3 227 8.0E-11
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 4 191 1.0E-10
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 4 227 1.0E-10
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 3 204 2.0E-10
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 5 183 3.0E-10
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 4 200 3.0E-10
sp|Q27979|RDH1_BOVIN 11-cis retinol dehydrogenase OS=Bos taurus GN=RDH5 PE=1 SV=1 2 191 6.0E-10
sp|Q07530|YD114_YEAST Uncharacterized oxidoreductase YDL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL114W PE=3 SV=1 1 200 7.0E-10
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 55 199 8.0E-10
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 8 182 9.0E-10
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 3 211 2.0E-09
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 4 198 3.0E-09
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 55 199 3.0E-09
sp|Q92781|RDH1_HUMAN 11-cis retinol dehydrogenase OS=Homo sapiens GN=RDH5 PE=1 SV=1 2 183 3.0E-09
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 8 180 4.0E-09
sp|Q9BPW9|DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens GN=DHRS9 PE=1 SV=1 4 199 5.0E-09
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 8 182 5.0E-09
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 3 182 6.0E-09
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 3 182 6.0E-09
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 4 227 6.0E-09
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 6 201 6.0E-09
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 4 247 8.0E-09
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 4 247 8.0E-09
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 5 215 8.0E-09
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 5 200 8.0E-09
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 7 215 1.0E-08
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 1 156 1.0E-08
sp|O55240|RDH1_MOUSE 11-cis retinol dehydrogenase OS=Mus musculus GN=Rdh5 PE=1 SV=1 2 187 1.0E-08
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 6 201 2.0E-08
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 9 202 2.0E-08
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 9 202 2.0E-08
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 9 202 2.0E-08
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 1 154 2.0E-08
sp|Q8VD48|DHRS9_RAT Dehydrogenase/reductase SDR family member 9 OS=Rattus norvegicus GN=Dhrs9 PE=2 SV=1 4 187 3.0E-08
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 7 183 3.0E-08
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 53 246 3.0E-08
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 76 199 4.0E-08
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 8 246 4.0E-08
sp|P50203|PHAB_ACISR Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 1 183 5.0E-08
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 8 180 5.0E-08
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 76 199 7.0E-08
sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 3 184 8.0E-08
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 5 224 9.0E-08
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 7 189 1.0E-07
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 76 199 1.0E-07
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 5 182 1.0E-07
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 5 182 1.0E-07
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 5 182 1.0E-07
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 3 202 1.0E-07
sp|Q6CVS4|MKAR_KLULA Very-long-chain 3-oxoacyl-CoA reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0B09812g PE=3 SV=1 6 221 2.0E-07
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 3 219 2.0E-07
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 5 192 2.0E-07
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 5 192 2.0E-07
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 8 241 2.0E-07
sp|A5E0R1|MKAR_LODEL Very-long-chain 3-oxoacyl-CoA reductase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_03198 PE=3 SV=1 7 182 2.0E-07
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 7 184 2.0E-07
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 5 183 2.0E-07
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 8 180 3.0E-07
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 7 181 3.0E-07
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 5 188 4.0E-07
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 6 196 5.0E-07
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 7 189 6.0E-07
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 1 258 6.0E-07
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 6 196 6.0E-07
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 5 195 6.0E-07
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 5 183 7.0E-07
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 6 201 8.0E-07
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 7 189 8.0E-07
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 6 196 8.0E-07
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 3 219 8.0E-07
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 3 219 8.0E-07
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 4 202 8.0E-07
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 2 187 8.0E-07
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 76 199 9.0E-07
sp|Q58NB6|DHRS9_MOUSE Dehydrogenase/reductase SDR family member 9 OS=Mus musculus GN=Dhrs9 PE=2 SV=2 4 187 9.0E-07
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 7 259 1.0E-06
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 7 256 1.0E-06
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 8 180 1.0E-06
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 6 187 1.0E-06
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 3 241 1.0E-06
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 3 200 1.0E-06
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 3 219 1.0E-06
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 3 219 1.0E-06
sp|P50233|DHI2_RAT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Rattus norvegicus GN=Hsd11b2 PE=1 SV=1 5 182 2.0E-06
sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 7 223 2.0E-06
sp|Q59V93|MKAR_CANAL Very-long-chain 3-oxoacyl-CoA reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.11340 PE=3 SV=2 2 221 2.0E-06
sp|Q6CHP1|MKAR_YARLI Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1 7 221 2.0E-06
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 7 256 2.0E-06
sp|A7F8T1|MKAR_SCLS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14012 PE=3 SV=1 7 223 2.0E-06
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 76 199 2.0E-06
sp|P80365|DHI2_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Homo sapiens GN=HSD11B2 PE=1 SV=2 5 210 2.0E-06
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 9 202 2.0E-06
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 5 227 3.0E-06
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 5 200 3.0E-06
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 6 196 3.0E-06
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 6 196 3.0E-06
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 4 236 3.0E-06
sp|P70385|DHB3_MOUSE Testosterone 17-beta-dehydrogenase 3 OS=Mus musculus GN=Hsd17b3 PE=1 SV=2 7 181 3.0E-06
sp|P51661|DHI2_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Mus musculus GN=Hsd11b2 PE=1 SV=2 5 204 4.0E-06
sp|P44481|Y048_HAEIN Uncharacterized oxidoreductase HI_0048 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0048 PE=1 SV=1 3 180 4.0E-06
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 8 259 4.0E-06
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 76 199 4.0E-06
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 9 210 5.0E-06
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 8 181 5.0E-06
sp|P50168|DHI2_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Ovis aries GN=HSD11B2 PE=2 SV=1 5 182 7.0E-06
sp|Q8HYR6|DHRS9_BOVIN Dehydrogenase/reductase SDR family member 9 OS=Bos taurus GN=DHRS9 PE=2 SV=1 5 249 7.0E-06
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 1 182 7.0E-06
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 5 189 9.0E-06
sp|A6ZLA1|MKAR_YEAS7 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0371 PE=3 SV=1 5 227 1.0E-05
sp|B3LN00|MKAR_YEAS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02811 PE=3 SV=1 5 227 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 138 160 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7711
MAEQRFALVTGCGQGGIGEALVKEYARRGLRPIATLLASEPSQHLDEAGIEWFPLDVTRKESVVELRKWVEGLTG
GRLDVLVNNAGKGEAKCKWREVAGADKTAYTMTAIDTDVGEVQQMFDVNLFGPMRMVHYFHDLLIQSAGIIVNIG
SVGGIVPYVYGSSYNASKAALHAWSNTLRVEMAALEVLTVISGEIGTNILKSDAARQLPQDSYYSPLAQEFEKHV
QRVPDTTSRFVYAEQVVAQSLKTVPAAWFWYGKTTSMVRLLDMFGWRTVFDGIFWNMFGLAKLRHGEKMKMK*
Coding >OphauB2|7711
ATGGCTGAGCAGAGGTTTGCGCTTGTCACGGGGTGCGGCCAAGGCGGCATTGGAGAGGCGCTGGTAAAGGAATAT
GCACGACGTGGTCTCCGCCCCATTGCCACGCTTCTTGCATCAGAGCCGAGCCAACACTTGGACGAGGCGGGGATA
GAATGGTTTCCGCTAGATGTTACGCGCAAAGAGTCGGTGGTTGAGTTGAGAAAGTGGGTAGAGGGGCTAACGGGC
GGGAGGCTTGATGTTTTGGTTAACAATGCGGGCAAAGGTGAGGCCAAGTGCAAATGGCGCGAGGTGGCTGGAGCT
GACAAGACAGCTTACACCATGACGGCGATTGACACCGACGTTGGGGAGGTGCAGCAAATGTTTGACGTTAATCTC
TTTGGGCCGATGCGCATGGTGCATTATTTTCACGACTTGCTGATTCAGTCGGCGGGCATAATTGTTAATATTGGC
TCGGTGGGCGGCATAGTGCCGTATGTGTATGGATCGTCGTATAATGCGTCCAAGGCGGCGTTGCATGCTTGGTCG
AATACGCTGCGTGTTGAAATGGCGGCGTTGGAGGTTCTGACGGTTATTTCGGGGGAGATTGGGACGAATATATTG
AAATCGGATGCGGCGCGACAGCTACCCCAAGACTCGTACTATTCACCTCTGGCGCAAGAGTTTGAGAAGCATGTG
CAGCGCGTTCCAGACACTACGAGTCGATTTGTGTATGCGGAGCAAGTCGTGGCGCAGAGTTTAAAGACGGTGCCG
GCAGCGTGGTTTTGGTATGGAAAGACGACGTCCATGGTGCGCCTTCTCGACATGTTTGGCTGGCGGACAGTATTT
GATGGGATTTTTTGGAACATGTTTGGGTTGGCAAAGCTGAGGCATGGGGAAAAGATGAAGATGAAGTGA
Transcript >OphauB2|7711
ATGGCTGAGCAGAGGTTTGCGCTTGTCACGGGGTGCGGCCAAGGCGGCATTGGAGAGGCGCTGGTAAAGGAATAT
GCACGACGTGGTCTCCGCCCCATTGCCACGCTTCTTGCATCAGAGCCGAGCCAACACTTGGACGAGGCGGGGATA
GAATGGTTTCCGCTAGATGTTACGCGCAAAGAGTCGGTGGTTGAGTTGAGAAAGTGGGTAGAGGGGCTAACGGGC
GGGAGGCTTGATGTTTTGGTTAACAATGCGGGCAAAGGTGAGGCCAAGTGCAAATGGCGCGAGGTGGCTGGAGCT
GACAAGACAGCTTACACCATGACGGCGATTGACACCGACGTTGGGGAGGTGCAGCAAATGTTTGACGTTAATCTC
TTTGGGCCGATGCGCATGGTGCATTATTTTCACGACTTGCTGATTCAGTCGGCGGGCATAATTGTTAATATTGGC
TCGGTGGGCGGCATAGTGCCGTATGTGTATGGATCGTCGTATAATGCGTCCAAGGCGGCGTTGCATGCTTGGTCG
AATACGCTGCGTGTTGAAATGGCGGCGTTGGAGGTTCTGACGGTTATTTCGGGGGAGATTGGGACGAATATATTG
AAATCGGATGCGGCGCGACAGCTACCCCAAGACTCGTACTATTCACCTCTGGCGCAAGAGTTTGAGAAGCATGTG
CAGCGCGTTCCAGACACTACGAGTCGATTTGTGTATGCGGAGCAAGTCGTGGCGCAGAGTTTAAAGACGGTGCCG
GCAGCGTGGTTTTGGTATGGAAAGACGACGTCCATGGTGCGCCTTCTCGACATGTTTGGCTGGCGGACAGTATTT
GATGGGATTTTTTGGAACATGTTTGGGTTGGCAAAGCTGAGGCATGGGGAAAAGATGAAGATGAAGTGA
Gene >OphauB2|7711
ATGGCTGAGCAGAGGTTTGCGCTTGTCACGGGGTATGTTGCGACTTTTTTTTCTTTGACTATTACAGTCTTGTAT
CTTGGCGTTGTTCCATTCACATTAGTTTGGCGTTGTTCCACTCACATTAGTGTGGCATTATTCCACTCATTGTCC
CTATTCCACTCTACTCAAATCATACCCATCACGCCAGCCTTGGACTTTACACATTACCCCTTTACTAACACGGCC
TAGGTGCGGCCAAGGCGGCATTGGAGAGGCGCTGGTAAAGGAATATGCACGACGTGGTCTCCGCCCCATTGCCAC
GCTTCTTGCATCAGAGCCGAGCCAACACTTGGACGAGGCGGGGATAGAATGGTTTCCGCTAGATGTTACGCGCAA
AGAGTCGGTGGTTGAGTTGAGAAAGTGGGTAGAGGGGCTAACGGGCGGGAGGCTTGATGTTTTGGTTAACAATGC
GTGAGTCTTGCTTCCCTTGATGTGAAGAAAGGAGTGGGCTAAGTGGAGTGGCAGGGGCAAAGGTGAGGCCAAGTG
CAAATGGCGCGAGGTGGCTGGAGCTGACAAGACAGCTTACACCATGACGGCGATTGACACCGACGTTGGGGAGGT
GCAGCAAATGTTTGACGTTAATCTCTTTGGGCCGATGCGCATGGTGCATTATTTTCACGACTTGCTGATTCAGTC
GGCGGGCATAATTGTTAATATTGGCTCGGTGGGCGGCATAGTGCCGTATGTGTATGGATGTGAGTCGCTTGATGA
GGTTTTTATGGAGGCTGCTGATGAAGTTAGCGTCGTATAATGCGTCCAAGGCGGCGTTGCATGCTTGGTCGAATA
CGCTGCGTGTTGAAATGGCGGCGTTGGAGTAAGTTTGCCTCGAGGATTTAGGGGAGGGGGAGCTAATTATGTGGT
AGTGTTAGGGTTCTGACGGTGAGTACGAGTGTGGGAGTGGTGTTGGCGTGGCTGAGAATGGGGGATAGGTTATTT
CGGGGGAGATTGGGACGAATATATTGAAATCGGATGCGGCGCGACAGCTACCCCAAGACTCGTACTATTCACCTC
TGGCGCAAGAGTTTGAGAAGCATGTGCAGCGCGTTCCAGGTATGTCTTTTTTTTTTTTTTCCTCCTTTTGATATT
TAAATTTTGGAGCATTTTGGCAGAGTCGAGGCTAATTTATAGACACTACGAGTCGATTTGTGTATGCGGAGCAAG
TCGTGGCGCAGAGTTTAAAGACGGTGCCGGCAGCGTGGTTTTGGTATGGAAAGACGACGTCCATGGTGCGCCTTC
TCGACATGTTTGGCTGGCGGACAGTATTTGTGAGTAAGAGGAAGAGATTGGGAGTGAGGAGTGCTAATGGTGGTT
AGGATGGGATTTTTTGGAACATGTTTGGGTTGGCAAAGCTGAGGCATGGGGAAAAGATGAAGATGAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail