Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7709
Gene name
LocationContig_86:56503..56880
Strand-
Gene length (bp)377
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 9.4E-14 6 96
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 9.5E-13 14 96
PF08659 KR KR domain 2.2E-07 5 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 7 97 1.0E-08
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 7 96 1.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 8 97 4.0E-07
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 9 96 6.0E-07
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 9 96 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 7 97 1.0E-08
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 7 96 1.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 8 97 4.0E-07
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 9 96 6.0E-07
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 9 96 6.0E-07
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 9 96 6.0E-07
sp|Q9Z2M4|DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 7 94 8.0E-07
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 7 96 2.0E-06
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 7 96 2.0E-06
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1 97 4.0E-06
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1 97 4.0E-06
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1 97 4.0E-06
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1 97 4.0E-06
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1 97 4.0E-06
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1 97 4.0E-06
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 7 94 4.0E-06
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 7 94 5.0E-06
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 7 94 5.0E-06
sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 7 94 5.0E-06
sp|O32185|YUSS_BACSU Short-chain dehydrogenase/reductase homolog YusS OS=Bacillus subtilis (strain 168) GN=yusS PE=5 SV=1 7 97 8.0E-06
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 7 97 9.0E-06
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 7 97 1.0E-05
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 8 97 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7709
MDITGHALIVGGGSGIGKGCALAFAREGAASVVVADIDLAAAEKSSAECKAVASRPGFESRALHMDVTLLDSVEG
GVAEMCKVFGRIDYCVNCAGVS*
Coding >OphauB2|7709
ATGGACATTACAGGCCACGCTCTCATTGTTGGCGGAGGGAGCGGTATCGGAAAAGGATGTGCCCTGGCATTCGCA
CGCGAGGGCGCAGCAAGCGTGGTTGTTGCGGATATTGACTTGGCAGCAGCTGAGAAGAGTAGTGCTGAGTGCAAG
GCTGTGGCCTCGCGGCCAGGGTTTGAAAGTAGAGCGCTGCACATGGACGTGACATTGCTTGACAGTGTCGAGGGA
GGCGTGGCTGAGATGTGCAAGGTGTTTGGCAGGATCGACTACTGCGTCAACTGCGCTGGGGTAAGCTGA
Transcript >OphauB2|7709
ATGGACATTACAGGCCACGCTCTCATTGTTGGCGGAGGGAGCGGTATCGGAAAAGGATGTGCCCTGGCATTCGCA
CGCGAGGGCGCAGCAAGCGTGGTTGTTGCGGATATTGACTTGGCAGCAGCTGAGAAGAGTAGTGCTGAGTGCAAG
GCTGTGGCCTCGCGGCCAGGGTTTGAAAGTAGAGCGCTGCACATGGACGTGACATTGCTTGACAGTGTCGAGGGA
GGCGTGGCTGAGATGTGCAAGGTGTTTGGCAGGATCGACTACTGCGTCAACTGCGCTGGGGTAAGCTGA
Gene >OphauB2|7709
ATGGACATTACAGGCCACGCTCTCATTGTTGGCGGAGGTGAGCATGCAGCGTTGGCCGTACTTGGTCATGATGGC
CGGGATGGCAAGGGACAGGCTAACGCAAAGACTTTGGACTTTTAGGGAGCGGTATCGGAAAAGGATGTGCCCTGG
CATTCGCACGCGAGGGCGCAGCAAGCGTGGTTGTTGCGGATATTGACTTGGCAGCAGCTGAGAAGAGTAGTGCTG
AGTGCAAGGCTGTGGCCTCGCGGCCAGGGTTTGAAAGTAGAGCGCTGCACATGGACGTGACATTGCTTGACAGTG
TCGAGGGAGGCGTGGCTGAGATGTGCAAGGTGTTTGGCAGGATCGACTACTGCGTCAACTGCGCTGGGGTAAGCT
GA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail