Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7703
Gene name
LocationContig_86:38066..39602
Strand-
Gene length (bp)1536
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 3.0E-10 48 139
PF08241 Methyltransf_11 Methyltransferase domain 3.6E-04 279 350
PF13649 Methyltransf_25 Methyltransferase domain 2.8E-13 47 135
PF08242 Methyltransf_12 Methyltransferase domain 2.0E-07 48 137
PF13489 Methyltransf_23 Methyltransferase domain 2.1E-09 40 194
PF13847 Methyltransf_31 Methyltransferase domain 2.5E-08 44 153

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7703
MATFSGRAAETLYDEVIHLYEDAYGSGTGIFNAIERIKSHHAPGSSVLDLGCGPGSPASELANAGFKVTGLDISQ
RALDICRERKIPGTFAKHDATTWDTKEQFDAVLMFFTTLTWSYRATYSVMFKVASWMRPGATFVLGTVDPQELKD
DKRLESVGYIERYPGRFLGKDFDATLITAEHWLDMIQQTGLSIVNVERFNHPVKERDSPEPQFFITATKRDVEPL
YGPYPIPMFARPAQVLDKDAWLPFAERLCRVEFDVALKAPHSTQLKLDTLELSAAIAKQAGHVHVTDLSAHNDTT
LPASSAITISRTAADHVALQARAVDAVIAVWILQYVDDVEKTLTEMTRVIDRSAPNARIVLIQGAPDHEVLRLVN
RACLPLADAAPPPPIHHQGQLLATAARVLSARGFGSITLERVDPHCSFQEDKLETRCAEAAAVLTNMWYKEHPQA
DKIKQTMLPLLREHFADRPFEIGTQSVIMVAQPSPAS*
Coding >OphauB2|7703
ATGGCCACCTTTTCGGGACGCGCTGCTGAAACCCTTTACGACGAGGTGATTCACTTGTATGAAGACGCTTACGGG
AGTGGCACTGGCATCTTCAATGCAATTGAGCGGATAAAGAGCCACCATGCGCCAGGATCGTCAGTCTTGGATCTT
GGCTGCGGCCCTGGAAGCCCAGCGTCTGAGCTAGCAAACGCAGGCTTCAAGGTGACGGGCCTCGACATTTCGCAA
CGCGCCCTTGATATTTGTCGGGAGAGAAAAATTCCCGGCACCTTTGCCAAGCATGACGCCACGACGTGGGATACA
AAGGAGCAGTTTGACGCCGTCTTGATGTTTTTTACTACGCTGACTTGGTCGTACCGGGCAACGTACTCGGTCATG
TTCAAGGTGGCGTCGTGGATGCGTCCTGGCGCGACATTTGTCTTGGGAACAGTTGATCCTCAAGAGCTCAAAGAC
GACAAGAGACTCGAGTCTGTGGGCTACATTGAGCGGTATCCCGGCCGCTTTCTCGGAAAAGACTTTGACGCGACG
CTCATTACTGCAGAGCACTGGCTCGACATGATTCAGCAGACTGGCCTATCGATTGTTAATGTTGAGCGATTCAAC
CACCCCGTCAAGGAAAGAGACTCTCCCGAGCCGCAATTCTTTATAACCGCCACAAAGAGGGACGTGGAGCCGCTT
TACGGACCGTACCCCATCCCCATGTTTGCGCGTCCAGCACAAGTCTTGGATAAAGATGCCTGGCTGCCGTTTGCC
GAGCGTCTCTGCCGCGTCGAGTTTGACGTGGCGCTCAAGGCTCCCCATTCAACCCAGCTTAAACTCGATACTCTA
GAACTATCAGCCGCCATTGCCAAACAAGCCGGCCACGTCCACGTCACAGACTTGAGCGCCCACAACGACACCACC
CTCCCCGCCAGCTCTGCCATTACCATTTCCCGCACCGCAGCAGACCATGTCGCCCTCCAAGCCCGTGCCGTCGAC
GCCGTCATAGCCGTCTGGATCCTGCAGTACGTCGACGACGTGGAAAAGACGCTCACGGAAATGACGCGCGTCATT
GACCGCTCTGCGCCAAACGCCCGCATCGTCCTCATCCAGGGCGCGCCCGACCACGAAGTCTTGCGTCTCGTGAAT
AGAGCTTGTCTGCCGCTCGCCGACGCGGCACCGCCTCCTCCCATCCATCATCAGGGACAGCTGCTCGCCACGGCG
GCCCGGGTCTTGTCGGCACGCGGCTTCGGCAGCATTACTCTTGAGCGAGTGGACCCGCACTGCAGCTTCCAAGAG
GACAAGCTGGAGACGCGATGCGCAGAGGCGGCGGCTGTGCTGACGAATATGTGGTACAAGGAGCATCCGCAAGCA
GACAAGATTAAGCAGACCATGCTTCCCTTGCTGCGAGAGCATTTTGCCGACAGGCCGTTTGAGATTGGAACCCAG
TCCGTAATCATGGTTGCCCAGCCGAGTCCTGCGTCCTAG
Transcript >OphauB2|7703
ATGGCCACCTTTTCGGGACGCGCTGCTGAAACCCTTTACGACGAGGTGATTCACTTGTATGAAGACGCTTACGGG
AGTGGCACTGGCATCTTCAATGCAATTGAGCGGATAAAGAGCCACCATGCGCCAGGATCGTCAGTCTTGGATCTT
GGCTGCGGCCCTGGAAGCCCAGCGTCTGAGCTAGCAAACGCAGGCTTCAAGGTGACGGGCCTCGACATTTCGCAA
CGCGCCCTTGATATTTGTCGGGAGAGAAAAATTCCCGGCACCTTTGCCAAGCATGACGCCACGACGTGGGATACA
AAGGAGCAGTTTGACGCCGTCTTGATGTTTTTTACTACGCTGACTTGGTCGTACCGGGCAACGTACTCGGTCATG
TTCAAGGTGGCGTCGTGGATGCGTCCTGGCGCGACATTTGTCTTGGGAACAGTTGATCCTCAAGAGCTCAAAGAC
GACAAGAGACTCGAGTCTGTGGGCTACATTGAGCGGTATCCCGGCCGCTTTCTCGGAAAAGACTTTGACGCGACG
CTCATTACTGCAGAGCACTGGCTCGACATGATTCAGCAGACTGGCCTATCGATTGTTAATGTTGAGCGATTCAAC
CACCCCGTCAAGGAAAGAGACTCTCCCGAGCCGCAATTCTTTATAACCGCCACAAAGAGGGACGTGGAGCCGCTT
TACGGACCGTACCCCATCCCCATGTTTGCGCGTCCAGCACAAGTCTTGGATAAAGATGCCTGGCTGCCGTTTGCC
GAGCGTCTCTGCCGCGTCGAGTTTGACGTGGCGCTCAAGGCTCCCCATTCAACCCAGCTTAAACTCGATACTCTA
GAACTATCAGCCGCCATTGCCAAACAAGCCGGCCACGTCCACGTCACAGACTTGAGCGCCCACAACGACACCACC
CTCCCCGCCAGCTCTGCCATTACCATTTCCCGCACCGCAGCAGACCATGTCGCCCTCCAAGCCCGTGCCGTCGAC
GCCGTCATAGCCGTCTGGATCCTGCAGTACGTCGACGACGTGGAAAAGACGCTCACGGAAATGACGCGCGTCATT
GACCGCTCTGCGCCAAACGCCCGCATCGTCCTCATCCAGGGCGCGCCCGACCACGAAGTCTTGCGTCTCGTGAAT
AGAGCTTGTCTGCCGCTCGCCGACGCGGCACCGCCTCCTCCCATCCATCATCAGGGACAGCTGCTCGCCACGGCG
GCCCGGGTCTTGTCGGCACGCGGCTTCGGCAGCATTACTCTTGAGCGAGTGGACCCGCACTGCAGCTTCCAAGAG
GACAAGCTGGAGACGCGATGCGCAGAGGCGGCGGCTGTGCTGACGAATATGTGGTACAAGGAGCATCCGCAAGCA
GACAAGATTAAGCAGACCATGCTTCCCTTGCTGCGAGAGCATTTTGCCGACAGGCCGTTTGAGATTGGAACCCAG
TCCGTAATCATGGTTGCCCAGCCGAGTCCTGCGTCCTAG
Gene >OphauB2|7703
ATGGCCACCTTTTCGGGACGCGCTGCTGAAACCCTTTACGACGAGGTGATTCACTTGTATGAAGACGCTTACGGG
AGTGGCACTGGCATCTTCAATGCAATTGAGCGGATAAAGAGCCACCATGCGCCAGGATCGTCAGTCTTGGATCTT
GGCTGCGGCCCTGGAAGCCCAGCGTCTGAGCTAGCAAACGCAGGCTTCAAGGTGACGGGCCTCGACATTTCGCAA
CGCGCCCTTGATATTTGTCGGGAGAGAAAAATTCCCGGCACCTTTGCCAAGCATGACGCCACGACGTGGGATACA
AAGGAGCAGTTTGACGCCGTCTTGATGTTTTTTACTACGCTGACTTGGTCGTACCGGGCAACGTACTCGGTCATG
TTCAAGGTGGCGTCGTGGATGCGTCCTGGCGCGACATTTGTCTTGGGAACAGTTGATCCTCAAGAGCTCAAAGAC
GACAAGAGACTCGAGTCTGTGGGCTACATTGAGCGGTATCCCGGCCGCTTTCTCGGAAAAGACTTTGACGCGACG
CTCATTACTGCAGAGCACTGGCTCGACATGATTCAGCAGACTGGCCTATCGATTGTTAATGTTGAGCGATTCAAC
CACCCCGTCAAGGAAAGAGACTCTCCCGAGCCGCAATTCTTTATAACCGCCACAAAGAGGGACGTGGAGCCGCTT
TACGGACCGTACCCCATCCCCATGTTTGCGCGTCCAGCACAAGTCTTGGATAAAGATGCCTGGCTGCCGTTTGCC
GAGCGTCTCTGCCGCGTCGAGTTTGACGTGGCGCTCAAGGCTGTCGAGTCGAATAATCGCATCGCCCACATTAGC
AACGGCCACGGAGGCAAGTCTCTAGTCCTGCCCTATTAGCCCCATTCAACCCAGCTTAAACTCGATACTCTAGAA
CTATCAGCCGCCATTGCCAAACAAGCCGGCCACGTCCACGTCACAGACTTGAGCGCCCACAACGACACCACCCTC
CCCGCCAGCTCTGCCATTACCATTTCCCGCACCGCAGCAGACCATGTCGCCCTCCAAGCCCGTGCCGTCGACGCC
GTCATAGCCGTCTGGATCCTGCAGTACGTCGACGACGTGGAAAAGACGCTCACGGAAATGACGCGCGTCATTGAC
CGCTCTGCGCCAAACGCCCGCATCGTCCTCATCCAGGGCGCGCCCGACCACGAAGTCTTGCGTCTCGTGAATAGA
GCTTGTCTGCCGCTCGCCGACGCGGCACCGCCTCCTCCCATCCATCATCAGGGACAGCTGCTCGCCACGGCGGCC
CGGGTCTTGTCGGCACGCGGCTTCGGCAGCATTACTCTTGAGCGAGTGGACCCGCACTGCAGCTTCCAAGAGGAC
AAGCTGGAGACGCGATGCGCAGAGGCGGCGGCTGTGCTGACGAATATGTGGTACAAGGAGCATCCGCAAGCAGAC
AAGATTAAGCAGACCATGCTTCCCTTGCTGCGAGAGCATTTTGCCGACAGGCCGTTTGAGATTGGAACCCAGTCC
GTAATCATGGTTGCCCAGCCGAGTCCTGCGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail