Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7696
Gene name
LocationContig_86:6163..9508
Strand+
Gene length (bp)3345
Transcript length (bp)3345
Coding sequence length (bp)3345
Protein length (aa) 1115

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 678 783 9.0E-13
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 683 781 8.0E-11
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 675 770 1.0E-10
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 671 769 2.0E-10
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 680 781 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 678 783 9.0E-13
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 683 781 8.0E-11
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 675 770 1.0E-10
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 671 769 2.0E-10
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 680 781 6.0E-10
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 678 776 9.0E-10
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 666 762 1.0E-09
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1099 3.0E-09
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 992 1110 3.0E-09
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 684 781 4.0E-09
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 4.0E-09
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 680 776 5.0E-09
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 1.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1099 2.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1087 2.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 3.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 3.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 3.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 9.0E-08
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1099 1.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 995 1110 2.0E-07
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 702 784 4.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 1013 1110 1.0E-06
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 677 754 2.0E-06
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 675 746 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7696
MKLPTLALWLGLALAVDPAARIRHGLNLTPQICTDPCTEGEFHHFKAQDFHGCLVHRDDGPHYGEVDCCPEGFGR
TDRYDSGFDDEGTTIYRTFEDKNGFCKKLSAPPPQPPSTSQLVPTSSTVVQPTHSIPQQCEPCQTGDFRLLKTVG
FYACVSGTNFAEVECCPDDYMTLIDEHVAGFSEGDDFLTKSGDRRHGYCTKPPPPASTFEPVPTSTTSQQCEPCQ
TGDFRFFEEEGLSACAFEGRYGPAFSEVECCPEGYINIEKEIEGIPYDGELLYKEYGGDHGYCQKPSPVLPTTLV
PPQCEPCDQGEFRFFKAVDFYGCVSNKSTSLYFTDVACCPEGYTSTDSSISGFDEEGEYFGRRSGGGHGFCQKLL
PPPASTAVIPTQSTTPQQCEPCQSGDFRFFRPEGFYGCVVHDPSSLLFTEVECCPDGYTRVDSRTSGFVDEGESW
DRINRRGGGFCQKPPPPTSTLQDSSTAVLPTQSTTPEKCEPCHSGDFRFFKSEGFYGCYFDQRPNRNVVWFGEVE
CCPDGFTRANSTTSGFDYEGRLLGKGDGGEHGFCEELPPPASTSDSSTVMPTSHMATSLKPMSTSILTTHLSTIR
NSSTLMSTLSSSEKAPSTLIPTMPPSSDQTLSSTLILTTSLPAPQIPSTLVRTTSFSRQTSSTLVTPLSTAEPPV
WDKTDNKTDNKTDNEADNKTDNKTDDKTDNKTDNKTDNKTDDKTDDKTDNKTDNKTDNKTDNKTDNKTDDKTDNK
TDDKTDNKTDNKTDNKTDNKPDHKTDITTNDITHFLYFCKNEARYQISFGFFEFINLPPQWNLVASSVSLRLVQR
VTATATASFDFELCQPQENRRVVTHVAGKYVYGSAIHVENKAPAPTRVSVQITIRTIICLTGNDYTRVTVSGKDV
HVEPVTVAQVEAVPDIKMKSKLLGQCSGSHCNMAPCQREECSFEARVSTCSGHHCVERVPARGVAQAPVKIEQAR
ILILEHRVHAAAGITVRIGPHGNAGRISNGDNKAGSNGNAHHIPNSDNKAEPHGNSEHIPNGDNKAEPHGNSEHI
PNGDNKAEPHGNSEPIPNGDKAEPHGSAEHIPNGDSKAAVKPAAKTKMICRRRTSSSKTLLSNA*
Coding >OphauB2|7696
ATGAAGTTGCCAACTCTTGCTCTCTGGCTGGGGCTAGCTTTGGCTGTTGACCCTGCTGCGAGGATTCGGCACGGG
TTGAATCTGACACCACAGATCTGTACTGATCCATGCACAGAGGGAGAGTTTCACCATTTTAAAGCGCAGGATTTC
CACGGATGTCTTGTTCATCGTGACGATGGTCCCCACTATGGAGAAGTCGACTGCTGTCCTGAGGGGTTCGGTCGT
ACTGACAGATATGATTCTGGATTTGATGACGAGGGCACCACGATATACAGGACGTTTGAAGATAAGAATGGCTTC
TGCAAGAAACTGTCTGCACCACCGCCTCAGCCGCCCTCGACTTCTCAGCTAGTGCCCACGTCGTCCACCGTGGTG
CAACCAACACACTCCATCCCTCAGCAGTGCGAGCCGTGCCAAACCGGAGATTTCCGCCTCTTGAAAACTGTGGGC
TTTTATGCATGCGTCTCTGGCACGAATTTTGCAGAAGTCGAATGCTGCCCTGATGACTATATGACTCTAATAGAT
GAACATGTTGCTGGATTTAGCGAGGGCGACGACTTCTTGACCAAGTCGGGGGACAGACGACATGGATATTGCACG
AAGCCGCCTCCGCCTGCCTCCACCTTTGAGCCGGTGCCCACGTCAACCACTTCTCAGCAGTGCGAGCCGTGTCAA
ACCGGAGATTTTCGCTTCTTTGAGGAAGAGGGCCTTTCTGCATGTGCCTTTGAGGGGAGATATGGCCCGGCCTTT
TCAGAAGTCGAATGCTGTCCTGAGGGATACATTAATATCGAAAAGGAGATTGAAGGAATTCCTTACGACGGCGAG
CTTTTATACAAGGAGTATGGCGGCGACCATGGATATTGCCAGAAGCCGTCTCCCGTGCTTCCAACAACCTTGGTC
CCCCCGCAATGCGAGCCCTGCGACCAAGGAGAATTTCGCTTCTTCAAGGCGGTGGACTTTTATGGATGCGTTTCC
AATAAGAGCACTAGCCTGTACTTTACAGACGTGGCCTGCTGTCCCGAGGGGTATACTAGCACCGATTCAAGTATT
TCCGGCTTCGACGAAGAAGGAGAATATTTTGGCAGAAGAAGTGGCGGAGGACACGGGTTTTGCCAGAAGCTGCTT
CCTCCGCCCGCCTCGACGGCCGTGATTCCCACGCAGTCGACGACTCCTCAGCAGTGCGAGCCCTGTCAATCAGGC
GACTTTCGCTTCTTCAGACCAGAGGGCTTTTATGGATGTGTCGTGCATGATCCCTCTAGTCTGTTATTTACAGAA
GTCGAATGCTGCCCTGATGGGTATACTCGCGTCGATTCACGTACTTCGGGGTTTGTCGACGAGGGAGAATCTTGG
GATAGAATTAATCGCCGAGGAGGCGGCTTTTGTCAGAAGCCGCCTCCGCCCACCTCGACTTTACAGGACTCGTCG
ACGGCTGTGCTTCCAACGCAGTCGACAACTCCTGAGAAATGCGAGCCCTGTCATTCAGGAGACTTTCGCTTCTTC
AAGTCGGAGGGCTTTTATGGATGTTATTTTGATCAAAGACCTAATAGGAATGTCGTTTGGTTTGGAGAAGTCGAA
TGCTGTCCTGATGGGTTTACCCGTGCTAATTCTACTACTTCGGGCTTTGATTACGAAGGAAGGCTTTTGGGTAAG
GGGGATGGTGGAGAGCATGGGTTTTGTGAAGAGCTGCCTCCGCCAGCCTCGACGTCGGATTCGTCGACGGTGATG
CCTACATCGCACATGGCGACTTCACTCAAGCCCATGTCGACATCAATTCTCACAACGCACTTGTCTACTATACGA
AACTCGTCAACACTGATGAGTACGCTCTCGTCTTCCGAAAAGGCACCCTCGACACTGATTCCTACAATGCCTCCG
TCTTCCGACCAGACATTGTCGTCGACGCTGATTCTTACAACCTCTTTGCCTGCTCCGCAGATACCCTCGACGCTG
GTGCGTACGACTTCGTTTTCTCGGCAGACGTCGTCGACTTTGGTGACGCCTTTATCAACTGCCGAGCCACCCGTA
TGGGACAAGACGGACAATAAGACGGACAATAAAACTGACAATGAGGCGGACAATAAAACGGACAATAAAACTGAC
GATAAAACCGACAATAAAACCGACAATAAAACCGACAATAAAACGGACGATAAAACGGACGATAAAACTGACAAC
AAGACGGACAATAAGACGGACAATAAAACGGACAATAAAACGGACAATAAAACGGACGATAAAACCGACAATAAA
ACGGACGATAAAACCGACAACAAGACGGACAATAAAACTGACAACAAGACGGACAACAAGCCTGACCACAAGACG
GACATCACCACCAACGACATTACGCACTTTCTCTACTTTTGCAAAAACGAGGCCCGCTACCAAATCAGCTTTGGC
TTCTTTGAATTCATCAACCTCCCACCTCAATGGAACCTCGTTGCCTCCTCCGTCAGTCTCCGTCTTGTCCAGCGC
GTCACTGCCACCGCAACCGCCTCATTTGACTTTGAGCTCTGCCAACCGCAAGAAAACCGCCGCGTCGTCACCCAC
GTTGCTGGAAAGTACGTCTACGGCTCAGCCATTCACGTCGAGAACAAGGCCCCTGCGCCCACCAGAGTCTCTGTC
CAAATCACCATTCGCACGATTATTTGCCTCACTGGCAATGATTACACGCGCGTCACTGTTAGTGGCAAGGATGTC
CATGTTGAGCCGGTTACCGTGGCGCAGGTCGAGGCTGTCCCGGATATCAAGATGAAGAGCAAGCTCCTTGGCCAG
TGCAGCGGCTCGCATTGTAACATGGCGCCCTGTCAGCGTGAAGAGTGCAGCTTCGAGGCTCGAGTTTCGACATGT
TCTGGCCACCATTGCGTTGAGCGGGTTCCTGCTCGTGGTGTTGCCCAGGCTCCCGTCAAGATTGAGCAGGCCAGG
ATTCTTATCCTTGAGCATCGTGTCCACGCCGCCGCTGGAATCACAGTCAGGATTGGACCCCATGGCAATGCCGGC
CGCATCTCTAATGGTGACAACAAGGCTGGATCCAATGGCAACGCCCACCACATCCCTAATAGCGACAACAAGGCT
GAACCCCATGGCAACTCCGAGCATATTCCTAATGGAGACAACAAGGCTGAACCTCATGGCAACTCCGAGCATATT
CCCAATGGAGACAACAAGGCTGAACCTCATGGCAACTCCGAGCCTATTCCCAATGGAGACAAGGCTGAACCCCAT
GGCAGCGCCGAGCATATTCCCAATGGAGACTCCAAGGCCGCCGTTAAGCCTGCTGCCAAGACCAAGATGATTTGC
AGGAGAAGGACTAGCTCAAGCAAAACCTTGCTGTCAAATGCTTGA
Transcript >OphauB2|7696
ATGAAGTTGCCAACTCTTGCTCTCTGGCTGGGGCTAGCTTTGGCTGTTGACCCTGCTGCGAGGATTCGGCACGGG
TTGAATCTGACACCACAGATCTGTACTGATCCATGCACAGAGGGAGAGTTTCACCATTTTAAAGCGCAGGATTTC
CACGGATGTCTTGTTCATCGTGACGATGGTCCCCACTATGGAGAAGTCGACTGCTGTCCTGAGGGGTTCGGTCGT
ACTGACAGATATGATTCTGGATTTGATGACGAGGGCACCACGATATACAGGACGTTTGAAGATAAGAATGGCTTC
TGCAAGAAACTGTCTGCACCACCGCCTCAGCCGCCCTCGACTTCTCAGCTAGTGCCCACGTCGTCCACCGTGGTG
CAACCAACACACTCCATCCCTCAGCAGTGCGAGCCGTGCCAAACCGGAGATTTCCGCCTCTTGAAAACTGTGGGC
TTTTATGCATGCGTCTCTGGCACGAATTTTGCAGAAGTCGAATGCTGCCCTGATGACTATATGACTCTAATAGAT
GAACATGTTGCTGGATTTAGCGAGGGCGACGACTTCTTGACCAAGTCGGGGGACAGACGACATGGATATTGCACG
AAGCCGCCTCCGCCTGCCTCCACCTTTGAGCCGGTGCCCACGTCAACCACTTCTCAGCAGTGCGAGCCGTGTCAA
ACCGGAGATTTTCGCTTCTTTGAGGAAGAGGGCCTTTCTGCATGTGCCTTTGAGGGGAGATATGGCCCGGCCTTT
TCAGAAGTCGAATGCTGTCCTGAGGGATACATTAATATCGAAAAGGAGATTGAAGGAATTCCTTACGACGGCGAG
CTTTTATACAAGGAGTATGGCGGCGACCATGGATATTGCCAGAAGCCGTCTCCCGTGCTTCCAACAACCTTGGTC
CCCCCGCAATGCGAGCCCTGCGACCAAGGAGAATTTCGCTTCTTCAAGGCGGTGGACTTTTATGGATGCGTTTCC
AATAAGAGCACTAGCCTGTACTTTACAGACGTGGCCTGCTGTCCCGAGGGGTATACTAGCACCGATTCAAGTATT
TCCGGCTTCGACGAAGAAGGAGAATATTTTGGCAGAAGAAGTGGCGGAGGACACGGGTTTTGCCAGAAGCTGCTT
CCTCCGCCCGCCTCGACGGCCGTGATTCCCACGCAGTCGACGACTCCTCAGCAGTGCGAGCCCTGTCAATCAGGC
GACTTTCGCTTCTTCAGACCAGAGGGCTTTTATGGATGTGTCGTGCATGATCCCTCTAGTCTGTTATTTACAGAA
GTCGAATGCTGCCCTGATGGGTATACTCGCGTCGATTCACGTACTTCGGGGTTTGTCGACGAGGGAGAATCTTGG
GATAGAATTAATCGCCGAGGAGGCGGCTTTTGTCAGAAGCCGCCTCCGCCCACCTCGACTTTACAGGACTCGTCG
ACGGCTGTGCTTCCAACGCAGTCGACAACTCCTGAGAAATGCGAGCCCTGTCATTCAGGAGACTTTCGCTTCTTC
AAGTCGGAGGGCTTTTATGGATGTTATTTTGATCAAAGACCTAATAGGAATGTCGTTTGGTTTGGAGAAGTCGAA
TGCTGTCCTGATGGGTTTACCCGTGCTAATTCTACTACTTCGGGCTTTGATTACGAAGGAAGGCTTTTGGGTAAG
GGGGATGGTGGAGAGCATGGGTTTTGTGAAGAGCTGCCTCCGCCAGCCTCGACGTCGGATTCGTCGACGGTGATG
CCTACATCGCACATGGCGACTTCACTCAAGCCCATGTCGACATCAATTCTCACAACGCACTTGTCTACTATACGA
AACTCGTCAACACTGATGAGTACGCTCTCGTCTTCCGAAAAGGCACCCTCGACACTGATTCCTACAATGCCTCCG
TCTTCCGACCAGACATTGTCGTCGACGCTGATTCTTACAACCTCTTTGCCTGCTCCGCAGATACCCTCGACGCTG
GTGCGTACGACTTCGTTTTCTCGGCAGACGTCGTCGACTTTGGTGACGCCTTTATCAACTGCCGAGCCACCCGTA
TGGGACAAGACGGACAATAAGACGGACAATAAAACTGACAATGAGGCGGACAATAAAACGGACAATAAAACTGAC
GATAAAACCGACAATAAAACCGACAATAAAACCGACAATAAAACGGACGATAAAACGGACGATAAAACTGACAAC
AAGACGGACAATAAGACGGACAATAAAACGGACAATAAAACGGACAATAAAACGGACGATAAAACCGACAATAAA
ACGGACGATAAAACCGACAACAAGACGGACAATAAAACTGACAACAAGACGGACAACAAGCCTGACCACAAGACG
GACATCACCACCAACGACATTACGCACTTTCTCTACTTTTGCAAAAACGAGGCCCGCTACCAAATCAGCTTTGGC
TTCTTTGAATTCATCAACCTCCCACCTCAATGGAACCTCGTTGCCTCCTCCGTCAGTCTCCGTCTTGTCCAGCGC
GTCACTGCCACCGCAACCGCCTCATTTGACTTTGAGCTCTGCCAACCGCAAGAAAACCGCCGCGTCGTCACCCAC
GTTGCTGGAAAGTACGTCTACGGCTCAGCCATTCACGTCGAGAACAAGGCCCCTGCGCCCACCAGAGTCTCTGTC
CAAATCACCATTCGCACGATTATTTGCCTCACTGGCAATGATTACACGCGCGTCACTGTTAGTGGCAAGGATGTC
CATGTTGAGCCGGTTACCGTGGCGCAGGTCGAGGCTGTCCCGGATATCAAGATGAAGAGCAAGCTCCTTGGCCAG
TGCAGCGGCTCGCATTGTAACATGGCGCCCTGTCAGCGTGAAGAGTGCAGCTTCGAGGCTCGAGTTTCGACATGT
TCTGGCCACCATTGCGTTGAGCGGGTTCCTGCTCGTGGTGTTGCCCAGGCTCCCGTCAAGATTGAGCAGGCCAGG
ATTCTTATCCTTGAGCATCGTGTCCACGCCGCCGCTGGAATCACAGTCAGGATTGGACCCCATGGCAATGCCGGC
CGCATCTCTAATGGTGACAACAAGGCTGGATCCAATGGCAACGCCCACCACATCCCTAATAGCGACAACAAGGCT
GAACCCCATGGCAACTCCGAGCATATTCCTAATGGAGACAACAAGGCTGAACCTCATGGCAACTCCGAGCATATT
CCCAATGGAGACAACAAGGCTGAACCTCATGGCAACTCCGAGCCTATTCCCAATGGAGACAAGGCTGAACCCCAT
GGCAGCGCCGAGCATATTCCCAATGGAGACTCCAAGGCCGCCGTTAAGCCTGCTGCCAAGACCAAGATGATTTGC
AGGAGAAGGACTAGCTCAAGCAAAACCTTGCTGTCAAATGCTTGA
Gene >OphauB2|7696
ATGAAGTTGCCAACTCTTGCTCTCTGGCTGGGGCTAGCTTTGGCTGTTGACCCTGCTGCGAGGATTCGGCACGGG
TTGAATCTGACACCACAGATCTGTACTGATCCATGCACAGAGGGAGAGTTTCACCATTTTAAAGCGCAGGATTTC
CACGGATGTCTTGTTCATCGTGACGATGGTCCCCACTATGGAGAAGTCGACTGCTGTCCTGAGGGGTTCGGTCGT
ACTGACAGATATGATTCTGGATTTGATGACGAGGGCACCACGATATACAGGACGTTTGAAGATAAGAATGGCTTC
TGCAAGAAACTGTCTGCACCACCGCCTCAGCCGCCCTCGACTTCTCAGCTAGTGCCCACGTCGTCCACCGTGGTG
CAACCAACACACTCCATCCCTCAGCAGTGCGAGCCGTGCCAAACCGGAGATTTCCGCCTCTTGAAAACTGTGGGC
TTTTATGCATGCGTCTCTGGCACGAATTTTGCAGAAGTCGAATGCTGCCCTGATGACTATATGACTCTAATAGAT
GAACATGTTGCTGGATTTAGCGAGGGCGACGACTTCTTGACCAAGTCGGGGGACAGACGACATGGATATTGCACG
AAGCCGCCTCCGCCTGCCTCCACCTTTGAGCCGGTGCCCACGTCAACCACTTCTCAGCAGTGCGAGCCGTGTCAA
ACCGGAGATTTTCGCTTCTTTGAGGAAGAGGGCCTTTCTGCATGTGCCTTTGAGGGGAGATATGGCCCGGCCTTT
TCAGAAGTCGAATGCTGTCCTGAGGGATACATTAATATCGAAAAGGAGATTGAAGGAATTCCTTACGACGGCGAG
CTTTTATACAAGGAGTATGGCGGCGACCATGGATATTGCCAGAAGCCGTCTCCCGTGCTTCCAACAACCTTGGTC
CCCCCGCAATGCGAGCCCTGCGACCAAGGAGAATTTCGCTTCTTCAAGGCGGTGGACTTTTATGGATGCGTTTCC
AATAAGAGCACTAGCCTGTACTTTACAGACGTGGCCTGCTGTCCCGAGGGGTATACTAGCACCGATTCAAGTATT
TCCGGCTTCGACGAAGAAGGAGAATATTTTGGCAGAAGAAGTGGCGGAGGACACGGGTTTTGCCAGAAGCTGCTT
CCTCCGCCCGCCTCGACGGCCGTGATTCCCACGCAGTCGACGACTCCTCAGCAGTGCGAGCCCTGTCAATCAGGC
GACTTTCGCTTCTTCAGACCAGAGGGCTTTTATGGATGTGTCGTGCATGATCCCTCTAGTCTGTTATTTACAGAA
GTCGAATGCTGCCCTGATGGGTATACTCGCGTCGATTCACGTACTTCGGGGTTTGTCGACGAGGGAGAATCTTGG
GATAGAATTAATCGCCGAGGAGGCGGCTTTTGTCAGAAGCCGCCTCCGCCCACCTCGACTTTACAGGACTCGTCG
ACGGCTGTGCTTCCAACGCAGTCGACAACTCCTGAGAAATGCGAGCCCTGTCATTCAGGAGACTTTCGCTTCTTC
AAGTCGGAGGGCTTTTATGGATGTTATTTTGATCAAAGACCTAATAGGAATGTCGTTTGGTTTGGAGAAGTCGAA
TGCTGTCCTGATGGGTTTACCCGTGCTAATTCTACTACTTCGGGCTTTGATTACGAAGGAAGGCTTTTGGGTAAG
GGGGATGGTGGAGAGCATGGGTTTTGTGAAGAGCTGCCTCCGCCAGCCTCGACGTCGGATTCGTCGACGGTGATG
CCTACATCGCACATGGCGACTTCACTCAAGCCCATGTCGACATCAATTCTCACAACGCACTTGTCTACTATACGA
AACTCGTCAACACTGATGAGTACGCTCTCGTCTTCCGAAAAGGCACCCTCGACACTGATTCCTACAATGCCTCCG
TCTTCCGACCAGACATTGTCGTCGACGCTGATTCTTACAACCTCTTTGCCTGCTCCGCAGATACCCTCGACGCTG
GTGCGTACGACTTCGTTTTCTCGGCAGACGTCGTCGACTTTGGTGACGCCTTTATCAACTGCCGAGCCACCCGTA
TGGGACAAGACGGACAATAAGACGGACAATAAAACTGACAATGAGGCGGACAATAAAACGGACAATAAAACTGAC
GATAAAACCGACAATAAAACCGACAATAAAACCGACAATAAAACGGACGATAAAACGGACGATAAAACTGACAAC
AAGACGGACAATAAGACGGACAATAAAACGGACAATAAAACGGACAATAAAACGGACGATAAAACCGACAATAAA
ACGGACGATAAAACCGACAACAAGACGGACAATAAAACTGACAACAAGACGGACAACAAGCCTGACCACAAGACG
GACATCACCACCAACGACATTACGCACTTTCTCTACTTTTGCAAAAACGAGGCCCGCTACCAAATCAGCTTTGGC
TTCTTTGAATTCATCAACCTCCCACCTCAATGGAACCTCGTTGCCTCCTCCGTCAGTCTCCGTCTTGTCCAGCGC
GTCACTGCCACCGCAACCGCCTCATTTGACTTTGAGCTCTGCCAACCGCAAGAAAACCGCCGCGTCGTCACCCAC
GTTGCTGGAAAGTACGTCTACGGCTCAGCCATTCACGTCGAGAACAAGGCCCCTGCGCCCACCAGAGTCTCTGTC
CAAATCACCATTCGCACGATTATTTGCCTCACTGGCAATGATTACACGCGCGTCACTGTTAGTGGCAAGGATGTC
CATGTTGAGCCGGTTACCGTGGCGCAGGTCGAGGCTGTCCCGGATATCAAGATGAAGAGCAAGCTCCTTGGCCAG
TGCAGCGGCTCGCATTGTAACATGGCGCCCTGTCAGCGTGAAGAGTGCAGCTTCGAGGCTCGAGTTTCGACATGT
TCTGGCCACCATTGCGTTGAGCGGGTTCCTGCTCGTGGTGTTGCCCAGGCTCCCGTCAAGATTGAGCAGGCCAGG
ATTCTTATCCTTGAGCATCGTGTCCACGCCGCCGCTGGAATCACAGTCAGGATTGGACCCCATGGCAATGCCGGC
CGCATCTCTAATGGTGACAACAAGGCTGGATCCAATGGCAACGCCCACCACATCCCTAATAGCGACAACAAGGCT
GAACCCCATGGCAACTCCGAGCATATTCCTAATGGAGACAACAAGGCTGAACCTCATGGCAACTCCGAGCATATT
CCCAATGGAGACAACAAGGCTGAACCTCATGGCAACTCCGAGCCTATTCCCAATGGAGACAAGGCTGAACCCCAT
GGCAGCGCCGAGCATATTCCCAATGGAGACTCCAAGGCCGCCGTTAAGCCTGCTGCCAAGACCAAGATGATTTGC
AGGAGAAGGACTAGCTCAAGCAAAACCTTGCTGTCAAATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail