Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7695
Gene name
LocationContig_86:3919..4849
Strand-
Gene length (bp)930
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13704 Glyco_tranf_2_4 Glycosyl transferase family 2 2.5E-13 57 158
PF01697 Glyco_transf_92 Glycosyltransferase family 92 1.4E-05 57 268

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6YRM6|Y8219_ORYSJ UPF0392 protein Os08g0121900 OS=Oryza sativa subsp. japonica GN=Os08g0121900 PE=2 SV=1 30 245 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 9 26 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7695
MHVWTRRRHYFLITVFFLLVFLLFNLEDPLSSAAVLSRGSSTAPRDEYIALCLAVKDQAQDLPEWLQHHYFNMGI
GKFYIMDDGSDPPMSSLAHTFGIPPSALEFYYSDKSQHLRRMQRTLYNRCVELARPKHHTWMAFLDADEFLDTPG
PESLRAILSAFEPVTSIGAVAINWHVHSSSGHLVRQPSVRGAYTQCLIDDDGEDGWLNRYVKSIVRLAAYKSMAT
PHFFHLENNSVTVGEHGDLVRDSWRRASRDRLAVHHYAVKSRQEMEQKINRSSANGNGRTWNFWNVVENEIPHVN
CSSMLRWLS*
Coding >OphauB2|7695
ATGCACGTCTGGACTAGGCGGCGACACTATTTCCTCATTACCGTTTTTTTCCTCCTCGTCTTTCTCCTTTTCAAT
CTCGAGGACCCCCTCTCCTCGGCTGCGGTGCTGAGCAGAGGAAGCAGCACGGCACCCCGAGATGAATACATTGCC
CTCTGCCTCGCAGTAAAGGACCAGGCGCAGGACCTCCCCGAATGGCTCCAGCACCACTACTTCAACATGGGCATC
GGCAAGTTCTACATCATGGACGATGGCTCTGATCCGCCCATGTCGTCCCTAGCCCACACCTTTGGCATACCCCCC
TCTGCCCTCGAGTTCTACTACAGCGATAAATCCCAACACCTGCGCCGCATGCAACGCACCCTCTACAACCGCTGC
GTCGAGCTAGCGCGCCCCAAACACCACACCTGGATGGCCTTTCTCGACGCTGACGAATTCCTCGACACTCCGGGA
CCAGAGTCTTTGCGCGCCATCCTCTCAGCCTTTGAACCAGTCACCTCCATTGGCGCCGTGGCTATAAACTGGCAC
GTCCACTCCTCGAGCGGACACCTCGTTCGCCAACCATCTGTCCGCGGCGCATATACCCAATGCCTCATTGACGAC
GACGGCGAAGACGGCTGGCTGAACCGCTACGTCAAATCCATTGTTCGCCTCGCTGCGTATAAATCAATGGCCACG
CCGCACTTTTTCCATCTCGAAAACAACTCCGTCACTGTTGGCGAGCATGGCGACTTGGTTAGAGACTCGTGGCGC
CGTGCCTCGCGTGATAGATTGGCGGTGCATCACTACGCCGTCAAGAGTAGGCAGGAAATGGAGCAAAAGATTAAC
CGGAGCAGCGCAAACGGCAACGGAAGGACGTGGAATTTTTGGAACGTTGTAGAGAATGAAATACCCCATGTGAAT
TGCTCAAGCATGCTTCGATGGCTATCATGA
Transcript >OphauB2|7695
ATGCACGTCTGGACTAGGCGGCGACACTATTTCCTCATTACCGTTTTTTTCCTCCTCGTCTTTCTCCTTTTCAAT
CTCGAGGACCCCCTCTCCTCGGCTGCGGTGCTGAGCAGAGGAAGCAGCACGGCACCCCGAGATGAATACATTGCC
CTCTGCCTCGCAGTAAAGGACCAGGCGCAGGACCTCCCCGAATGGCTCCAGCACCACTACTTCAACATGGGCATC
GGCAAGTTCTACATCATGGACGATGGCTCTGATCCGCCCATGTCGTCCCTAGCCCACACCTTTGGCATACCCCCC
TCTGCCCTCGAGTTCTACTACAGCGATAAATCCCAACACCTGCGCCGCATGCAACGCACCCTCTACAACCGCTGC
GTCGAGCTAGCGCGCCCCAAACACCACACCTGGATGGCCTTTCTCGACGCTGACGAATTCCTCGACACTCCGGGA
CCAGAGTCTTTGCGCGCCATCCTCTCAGCCTTTGAACCAGTCACCTCCATTGGCGCCGTGGCTATAAACTGGCAC
GTCCACTCCTCGAGCGGACACCTCGTTCGCCAACCATCTGTCCGCGGCGCATATACCCAATGCCTCATTGACGAC
GACGGCGAAGACGGCTGGCTGAACCGCTACGTCAAATCCATTGTTCGCCTCGCTGCGTATAAATCAATGGCCACG
CCGCACTTTTTCCATCTCGAAAACAACTCCGTCACTGTTGGCGAGCATGGCGACTTGGTTAGAGACTCGTGGCGC
CGTGCCTCGCGTGATAGATTGGCGGTGCATCACTACGCCGTCAAGAGTAGGCAGGAAATGGAGCAAAAGATTAAC
CGGAGCAGCGCAAACGGCAACGGAAGGACGTGGAATTTTTGGAACGTTGTAGAGAATGAAATACCCCATGTGAAT
TGCTCAAGCATGCTTCGATGGCTATCATGA
Gene >OphauB2|7695
ATGCACGTCTGGACTAGGCGGCGACACTATTTCCTCATTACCGTTTTTTTCCTCCTCGTCTTTCTCCTTTTCAAT
CTCGAGGACCCCCTCTCCTCGGCTGCGGTGCTGAGCAGAGGAAGCAGCACGGCACCCCGAGATGAATACATTGCC
CTCTGCCTCGCAGTAAAGGACCAGGCGCAGGACCTCCCCGAATGGCTCCAGCACCACTACTTCAACATGGGCATC
GGCAAGTTCTACATCATGGACGATGGCTCTGATCCGCCCATGTCGTCCCTAGCCCACACCTTTGGCATACCCCCC
TCTGCCCTCGAGTTCTACTACAGCGATAAATCCCAACACCTGCGCCGCATGCAACGCACCCTCTACAACCGCTGC
GTCGAGCTAGCGCGCCCCAAACACCACACCTGGATGGCCTTTCTCGACGCTGACGAATTCCTCGACACTCCGGGA
CCAGAGTCTTTGCGCGCCATCCTCTCAGCCTTTGAACCAGTCACCTCCATTGGCGCCGTGGCTATAAACTGGCAC
GTCCACTCCTCGAGCGGACACCTCGTTCGCCAACCATCTGTCCGCGGCGCATATACCCAATGCCTCATTGACGAC
GACGGCGAAGACGGCTGGCTGAACCGCTACGTCAAATCCATTGTTCGCCTCGCTGCGTATAAATCAATGGCCACG
CCGCACTTTTTCCATCTCGAAAACAACTCCGTCACTGTTGGCGAGCATGGCGACTTGGTTAGAGACTCGTGGCGC
CGTGCCTCGCGTGATAGATTGGCGGTGCATCACTACGCCGTCAAGAGTAGGCAGGAAATGGAGCAAAAGATTAAC
CGGAGCAGCGCAAACGGCAACGGAAGGACGTGGAATTTTTGGAACGTTGTAGAGAATGAAATACCCCATGTGAAT
TGCTCAAGCATGCTTCGATGGCTATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail