Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7694
Gene name
LocationContig_86:1774..3323
Strand+
Gene length (bp)1549
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.4E-52 76 468

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 60 490 0.0E+00

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 75 94 19
2 99 121 22
3 154 176 22
4 186 208 22
5 215 237 22
6 257 276 19
7 296 318 22
8 338 360 22
9 381 403 22
10 413 432 19
11 444 466 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7694
MADLSYAPVQADSGSEKKQGLDKVASASNNIGQPTSSDSGMTGGAIAGEISEFEERRADMDKEKAAQGAAHFNRL
GWKRLTIVLIVEAIALGSLSLPAAFATLGMVAGVFCSVGLGLVAIYTSDIVGKVKLKYPHVAHYADAGRLIAGRF
GYELFGAMFVLQLTFLVGSHCLTGTIAFLNITDNGACSVVFGVVSAIILLALAVPPSFAEVAILGYIDFASILAA
IGVTIIATGIVAGNQDGGLSAVNWSAWPKEGVTFSDAFIAISNIVFAYSFCMCQFSFMDEMHTPSDYVKSIWALG
AIEIAIYTITGALVYSFVGVDVKSPSLLSAGTLISKVAFGLALPVIFISGSINTTVIGRYLHGRMFRNSVTRFIN
TPRGWITWLIVITIITLAAFIIAEVIPFFSDLLSISSSLFVSGFSYYLPAVMWYMLIREGPWYARHNLLHSACSA
LSFIIGVVTLVSGTYASIVDIMHQYEKGTVRGVFACAPIA*
Coding >OphauB2|7694
ATGGCGGACCTTAGCTACGCGCCCGTCCAGGCCGACTCTGGGTCGGAAAAGAAGCAGGGCTTGGACAAGGTGGCG
TCGGCCTCGAACAATATTGGCCAACCGACATCGTCAGACAGCGGCATGACGGGAGGCGCCATTGCTGGCGAGATT
AGCGAGTTTGAGGAGCGGAGAGCCGACATGGACAAGGAAAAGGCGGCCCAGGGCGCCGCACACTTTAACCGCCTC
GGCTGGAAACGACTCACCATTGTCCTCATTGTCGAAGCCATTGCCCTCGGCAGTCTCAGTTTGCCCGCCGCCTTT
GCCACGCTCGGCATGGTTGCCGGTGTCTTTTGCTCCGTTGGCCTGGGCCTCGTGGCCATTTACACGAGCGACATT
GTCGGCAAGGTCAAGCTCAAATACCCCCACGTCGCCCACTATGCTGATGCCGGCCGTCTGATTGCCGGCAGATTT
GGCTACGAATTGTTTGGCGCCATGTTTGTCTTGCAGCTCACCTTTCTCGTCGGCTCCCACTGCCTGACGGGCACC
ATTGCCTTTCTCAACATTACCGATAATGGTGCCTGCTCCGTCGTCTTTGGTGTCGTGTCCGCCATTATCCTGCTT
GCGCTGGCTGTGCCTCCGTCGTTTGCCGAGGTGGCCATTCTCGGGTATATTGATTTCGCCTCGATTCTTGCTGCC
ATTGGCGTCACCATCATCGCCACGGGCATTGTTGCTGGCAATCAAGACGGCGGACTCTCTGCCGTCAACTGGTCC
GCCTGGCCCAAGGAGGGCGTCACCTTTTCCGACGCCTTTATTGCCATTAGCAACATTGTCTTTGCCTATAGCTTC
TGCATGTGCCAATTCAGCTTCATGGACGAGATGCATACCCCTAGCGACTATGTCAAGTCGATTTGGGCGCTTGGT
GCCATTGAAATCGCCATTTACACAATTACTGGCGCCCTCGTCTACTCGTTTGTCGGCGTCGATGTCAAGTCGCCC
TCGCTCCTGTCGGCCGGCACGCTTATTTCAAAGGTTGCCTTTGGCCTGGCCCTGCCCGTCATCTTCATCTCGGGC
TCCATCAATACCACCGTCATTGGCCGCTACCTCCACGGGCGCATGTTTAGAAACTCGGTCACGCGCTTCATCAAT
ACGCCTCGCGGCTGGATTACGTGGCTCATTGTCATTACCATTATTACGCTGGCCGCCTTTATCATTGCCGAGGTT
ATCCCGTTTTTCAGCGACTTGCTGTCCATTTCGTCGTCGCTCTTTGTCTCGGGCTTTAGCTACTACCTGCCGGCC
GTTATGTGGTATATGCTGATTCGCGAGGGACCATGGTACGCGCGGCACAACCTCTTGCACTCTGCCTGCAGCGCC
TTGTCCTTTATCATTGGCGTCGTGACGCTCGTGAGCGGAACATATGCCAGTATCGTCGATATTATGCACCAATAC
GAAAAGGGCACCGTACGCGGCGTCTTTGCCTGCGCGCCAATCGCATAA
Transcript >OphauB2|7694
ATGGCGGACCTTAGCTACGCGCCCGTCCAGGCCGACTCTGGGTCGGAAAAGAAGCAGGGCTTGGACAAGGTGGCG
TCGGCCTCGAACAATATTGGCCAACCGACATCGTCAGACAGCGGCATGACGGGAGGCGCCATTGCTGGCGAGATT
AGCGAGTTTGAGGAGCGGAGAGCCGACATGGACAAGGAAAAGGCGGCCCAGGGCGCCGCACACTTTAACCGCCTC
GGCTGGAAACGACTCACCATTGTCCTCATTGTCGAAGCCATTGCCCTCGGCAGTCTCAGTTTGCCCGCCGCCTTT
GCCACGCTCGGCATGGTTGCCGGTGTCTTTTGCTCCGTTGGCCTGGGCCTCGTGGCCATTTACACGAGCGACATT
GTCGGCAAGGTCAAGCTCAAATACCCCCACGTCGCCCACTATGCTGATGCCGGCCGTCTGATTGCCGGCAGATTT
GGCTACGAATTGTTTGGCGCCATGTTTGTCTTGCAGCTCACCTTTCTCGTCGGCTCCCACTGCCTGACGGGCACC
ATTGCCTTTCTCAACATTACCGATAATGGTGCCTGCTCCGTCGTCTTTGGTGTCGTGTCCGCCATTATCCTGCTT
GCGCTGGCTGTGCCTCCGTCGTTTGCCGAGGTGGCCATTCTCGGGTATATTGATTTCGCCTCGATTCTTGCTGCC
ATTGGCGTCACCATCATCGCCACGGGCATTGTTGCTGGCAATCAAGACGGCGGACTCTCTGCCGTCAACTGGTCC
GCCTGGCCCAAGGAGGGCGTCACCTTTTCCGACGCCTTTATTGCCATTAGCAACATTGTCTTTGCCTATAGCTTC
TGCATGTGCCAATTCAGCTTCATGGACGAGATGCATACCCCTAGCGACTATGTCAAGTCGATTTGGGCGCTTGGT
GCCATTGAAATCGCCATTTACACAATTACTGGCGCCCTCGTCTACTCGTTTGTCGGCGTCGATGTCAAGTCGCCC
TCGCTCCTGTCGGCCGGCACGCTTATTTCAAAGGTTGCCTTTGGCCTGGCCCTGCCCGTCATCTTCATCTCGGGC
TCCATCAATACCACCGTCATTGGCCGCTACCTCCACGGGCGCATGTTTAGAAACTCGGTCACGCGCTTCATCAAT
ACGCCTCGCGGCTGGATTACGTGGCTCATTGTCATTACCATTATTACGCTGGCCGCCTTTATCATTGCCGAGGTT
ATCCCGTTTTTCAGCGACTTGCTGTCCATTTCGTCGTCGCTCTTTGTCTCGGGCTTTAGCTACTACCTGCCGGCC
GTTATGTGGTATATGCTGATTCGCGAGGGACCATGGTACGCGCGGCACAACCTCTTGCACTCTGCCTGCAGCGCC
TTGTCCTTTATCATTGGCGTCGTGACGCTCGTGAGCGGAACATATGCCAGTATCGTCGATATTATGCACCAATAC
GAAAAGGGCACCGTACGCGGCGTCTTTGCCTGCGCGCCAATCGCATAA
Gene >OphauB2|7694
ATGGCGGACCTTAGCTACGCGCCCGTCCAGGCCGACTCTGGGTCGGAAAAGAAGCAGGGCTTGGACAAGGTGGCG
TCGGCCTCGAACAATATTGGCCAACCGACATCGTCAGACAGCGGCATGACGGGAGGCGCCATTGCTGGCGAGATT
AGCGAGTTTGAGGAGCGGAGAGCCGACATGGACAAGGAAAAGGCGGCCCAGGGCGCCGCACACTTTAACCGCCTC
GGCTGGAAACGACTCACCATTGTCCTCATTGTCGAAGCCATTGCCCTCGGCAGTCTCAGTTTGCCCGCCGCCTTT
GCCACGCTCGGCATGGTTGCCGGTGTCTTTTGCTCCGTTGGCCTGGGCCTCGTGGCCATTTACACGAGCGACATT
GTCGGCAAGGTCAAGCTCAAATACCCCCACGTCGCCCACTATGCTGATGCCGGCCGTCTGATTGCCGGCAGATTT
GGCTACGAATTGTTTGGCGCCATGTTTGTCTTGCAGCTCACCTTTCTCGTCGGCTCCCACTGCCTGACGGGCACC
ATTGCCTTTCTCAACATTACCGATAATGGTGCCTGCTCCGTCGTCTTTGGTGTCGTGTCCGCCATTATCCTGCTT
GCGCTGGCTGTGCCTCCGTCGTTTGCCGAGGTGGCCATTCTCGGGTATATTGATTTCGCCTCGATTCTTGCTGCC
ATTGGCGTCACCATCATCGCCACGGGCATTGTTGCTGGCAATCAAGACGGCGGACTCTCTGCCGTCAACTGGTCC
GCCTGGCCCAAGGAGGGCGTCACCTTTTCCGACGCCTTTATTGCCATTAGCAACATTGTCTTTGCCTATAGCTTC
TGCATGTGCCAATTCAGCTTCATGGACGAGATGCATACCCCTAGCGACTATGTCAAGTCGATTTGGGCGCTTGGT
GCCATTGAAATCGCCATTTACACAATTACTGGCGCCCTCGTCTACTCGTTTGTCGGCGTCGATGTCAAGTCGCCC
TCGCTCCTGTCGGCCGGCACGCTTATTTCAAAGGTTGCCTTTGGCCTGGCCCTGCCCGTCATCTTCATCTCGGGC
TCCATCAATACCACCGTCATTGGCCGCTACCTCCACGGGCGCATGTTTAGAAACTCGGTCACGCGCTTCATCAAT
ACGCCTCGCGGCTGGATTACGTGGCTCATTGTCATTACCATTATTACGCTGGCCGCCTTTATCATTGCCGAGGTT
ATCCCGTTTTTCAGCGACTTGCTGTCCATTTCGTCGTCGCTCTTTGTCTCGGGCTTTAGCTACTACCTGCCGGCC
GTTATGTGGTATATGCTGATTCGCGAGGGACCATGGTACGCGCGGCACAACCTCTTGCACTCTGCCTGCAGCGCC
TTGTCCTTTATCATTGGCGTCGTGACGCTCGTGAGCGGAACATATGCCAGTATCGTCGATATTGTAAGCCCCCCC
CCCCTTTTTTTTTGCCTTGGGAGTTTTTGTACATGGCCAAGTCTCTAACCCGCCATTTCTGCAGATGCACCAATA
CGAAAAGGGCACCGTACGCGGCGTCTTTGCCTGCGCGCCAATCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail