Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7692
Gene name
LocationContig_85:76203..78306
Strand-
Gene length (bp)2103
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.0E-30 290 480
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-18 520 633
PF04851 ResIII Type III restriction enzyme, res subunit 2.1E-05 291 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 152 693 8.0E-97
sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 217 700 3.0E-83
sp|Q59MW2|DBP6_CANAL ATP-dependent RNA helicase DBP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP6 PE=3 SV=1 180 694 2.0E-75
sp|A3LSJ2|DBP6_PICST ATP-dependent RNA helicase DBP6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP6 PE=3 SV=2 224 695 2.0E-73
sp|A5DK47|DBP6_PICGU ATP-dependent RNA helicase DBP6 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP6 PE=3 SV=2 192 655 2.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 152 693 8.0E-97
sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 217 700 3.0E-83
sp|Q59MW2|DBP6_CANAL ATP-dependent RNA helicase DBP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP6 PE=3 SV=1 180 694 2.0E-75
sp|A3LSJ2|DBP6_PICST ATP-dependent RNA helicase DBP6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP6 PE=3 SV=2 224 695 2.0E-73
sp|A5DK47|DBP6_PICGU ATP-dependent RNA helicase DBP6 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP6 PE=3 SV=2 192 655 2.0E-69
sp|A7TFZ9|DBP6_VANPO ATP-dependent RNA helicase DBP6 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP6 PE=3 SV=1 192 652 5.0E-66
sp|Q6CKZ4|DBP6_KLULA ATP-dependent RNA helicase DBP6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP6 PE=3 SV=1 181 652 2.0E-63
sp|A5E726|DBP6_LODEL ATP-dependent RNA helicase DBP6 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP6 PE=3 SV=1 252 690 5.0E-63
sp|Q6BPT8|DBP6_DEBHA ATP-dependent RNA helicase DBP6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP6 PE=3 SV=2 252 657 8.0E-63
sp|Q6CDN5|DBP6_YARLI ATP-dependent RNA helicase DBP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP6 PE=3 SV=1 152 661 3.0E-62
sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1 252 660 1.0E-60
sp|A6ZSB3|DBP6_YEAS7 ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP6 PE=3 SV=1 193 651 6.0E-60
sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3 249 699 2.0E-59
sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=1 SV=1 249 699 2.0E-59
sp|P53734|DBP6_YEAST ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP6 PE=1 SV=1 193 651 2.0E-58
sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 252 657 1.0E-57
sp|P26802|DDX51_DROME Probable ATP-dependent RNA helicase Dbp73D OS=Drosophila melanogaster GN=Dbp73D PE=2 SV=3 249 693 8.0E-57
sp|Q751D1|DBP6_ASHGO ATP-dependent RNA helicase DBP6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP6 PE=3 SV=1 192 653 3.0E-56
sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 249 699 3.0E-56
sp|Q6FST5|DBP6_CANGA ATP-dependent RNA helicase DBP6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP6 PE=3 SV=1 183 653 3.0E-56
sp|Q54BD6|DDX51_DICDI Probable ATP-dependent RNA helicase ddx51 OS=Dictyostelium discoideum GN=ddx51 PE=3 SV=1 270 657 1.0E-46
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 241 646 6.0E-46
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 258 646 5.0E-45
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 258 646 5.0E-45
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 267 646 6.0E-44
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 250 657 5.0E-43
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 267 648 9.0E-43
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 264 646 9.0E-43
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 267 646 2.0E-42
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 267 643 3.0E-42
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 259 672 6.0E-42
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 267 673 7.0E-42
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 267 673 1.0E-41
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 257 657 2.0E-41
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 267 646 2.0E-41
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 263 646 2.0E-41
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 260 657 2.0E-41
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 261 646 1.0E-40
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 238 659 1.0E-40
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 265 646 1.0E-40
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 267 647 7.0E-40
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 267 695 8.0E-40
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 260 643 2.0E-39
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 265 643 4.0E-39
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 267 646 1.0E-38
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 267 647 1.0E-38
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 267 659 2.0E-38
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 257 657 2.0E-38
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 265 657 2.0E-38
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 266 698 4.0E-38
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 261 688 2.0E-37
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 265 698 4.0E-37
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 260 698 6.0E-37
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 191 654 8.0E-37
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 267 642 1.0E-36
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 232 643 1.0E-36
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 265 654 1.0E-36
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 266 698 2.0E-36
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 265 654 2.0E-36
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 267 642 2.0E-36
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 265 654 3.0E-36
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 256 642 3.0E-36
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 232 643 3.0E-36
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 265 654 4.0E-36
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 265 643 5.0E-36
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 267 654 5.0E-36
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 267 696 1.0E-35
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 267 645 1.0E-35
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 265 672 2.0E-35
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 265 656 2.0E-35
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 265 656 2.0E-35
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 267 647 2.0E-35
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 265 656 2.0E-35
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 267 654 2.0E-35
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 260 681 3.0E-35
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 260 681 3.0E-35
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 265 656 4.0E-35
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 252 685 5.0E-35
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 265 654 7.0E-35
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 267 651 8.0E-35
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 266 653 1.0E-34
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 240 647 2.0E-34
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 309 663 3.0E-34
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 267 647 4.0E-34
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 265 654 5.0E-34
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 265 647 6.0E-34
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 260 654 6.0E-34
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 252 696 6.0E-34
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 252 696 6.0E-34
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 267 676 7.0E-34
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 257 663 7.0E-34
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 267 687 8.0E-34
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 267 678 8.0E-34
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 267 647 8.0E-34
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 267 647 8.0E-34
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 267 653 2.0E-33
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 266 659 3.0E-33
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 258 654 3.0E-33
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 265 659 4.0E-33
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 263 642 4.0E-33
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 266 647 4.0E-33
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 264 642 4.0E-33
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 265 653 4.0E-33
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 206 673 6.0E-33
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 261 647 6.0E-33
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 267 654 6.0E-33
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 266 651 8.0E-33
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 266 654 9.0E-33
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 267 657 9.0E-33
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 267 642 1.0E-32
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 264 632 1.0E-32
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 267 654 1.0E-32
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 244 673 1.0E-32
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 267 654 1.0E-32
sp|Q86IZ9|DDX52_DICDI Probable ATP-dependent RNA helicase ddx52 OS=Dictyostelium discoideum GN=ddx52 PE=3 SV=1 253 648 1.0E-32
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 238 673 2.0E-32
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 261 642 2.0E-32
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 265 643 2.0E-32
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 263 642 2.0E-32
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 261 672 2.0E-32
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 257 647 2.0E-32
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 267 647 2.0E-32
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 269 654 3.0E-32
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 263 642 4.0E-32
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 265 647 4.0E-32
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 258 654 4.0E-32
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 309 642 5.0E-32
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 267 643 6.0E-32
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 267 650 7.0E-32
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 237 651 7.0E-32
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 249 673 9.0E-32
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 265 642 9.0E-32
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 252 642 1.0E-31
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 267 659 1.0E-31
sp|A5DLF4|DBP4_PICGU ATP-dependent RNA helicase DBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP4 PE=3 SV=2 266 647 1.0E-31
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 257 647 1.0E-31
sp|Q84T03|RH27_ORYSJ DEAD-box ATP-dependent RNA helicase 27 OS=Oryza sativa subsp. japonica GN=Os03g0802700 PE=3 SV=1 267 635 2.0E-31
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 247 673 2.0E-31
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 249 673 2.0E-31
sp|Q6FPT7|DBP4_CANGA ATP-dependent RNA helicase DBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP4 PE=3 SV=1 267 657 2.0E-31
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 267 654 2.0E-31
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 259 654 3.0E-31
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 254 651 3.0E-31
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 243 651 3.0E-31
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 244 651 5.0E-31
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 265 648 6.0E-31
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 270 647 7.0E-31
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 267 698 7.0E-31
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 265 651 9.0E-31
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 259 654 1.0E-30
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 262 658 1.0E-30
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 265 654 1.0E-30
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 265 654 1.0E-30
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 265 654 1.0E-30
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 265 654 1.0E-30
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 265 654 1.0E-30
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 265 654 1.0E-30
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 265 654 1.0E-30
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 267 651 1.0E-30
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 265 651 1.0E-30
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 265 654 2.0E-30
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 267 672 2.0E-30
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 266 650 2.0E-30
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 264 653 2.0E-30
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 266 651 2.0E-30
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 266 651 2.0E-30
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 264 653 2.0E-30
sp|Q0D622|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2 260 643 3.0E-30
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 267 651 3.0E-30
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 267 651 3.0E-30
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 266 654 3.0E-30
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 261 644 3.0E-30
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 267 651 5.0E-30
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 262 637 5.0E-30
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 267 658 6.0E-30
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 267 654 7.0E-30
sp|Q9D0R4|DDX56_MOUSE Probable ATP-dependent RNA helicase DDX56 OS=Mus musculus GN=Ddx56 PE=2 SV=1 257 651 8.0E-30
sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 267 643 8.0E-30
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 266 632 8.0E-30
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 267 643 1.0E-29
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 261 651 1.0E-29
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 271 650 1.0E-29
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 266 664 1.0E-29
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 267 681 1.0E-29
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 267 632 1.0E-29
sp|Q6ATJ8|RH16_ORYSJ DEAD-box ATP-dependent RNA helicase 16 OS=Oryza sativa subsp. japonica GN=Os03g0728800 PE=2 SV=1 267 651 2.0E-29
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 267 632 2.0E-29
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 269 648 2.0E-29
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 169 659 2.0E-29
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 269 669 2.0E-29
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 267 663 2.0E-29
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 267 653 3.0E-29
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 267 644 3.0E-29
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 265 643 3.0E-29
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 290 655 3.0E-29
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 257 642 4.0E-29
sp|A7TJ71|DBP4_VANPO ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1 267 653 4.0E-29
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 270 642 5.0E-29
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 258 643 6.0E-29
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 267 632 6.0E-29
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 267 644 7.0E-29
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 267 644 9.0E-29
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 267 647 1.0E-28
sp|Q8K301|DDX52_MOUSE Probable ATP-dependent RNA helicase DDX52 OS=Mus musculus GN=Ddx52 PE=2 SV=2 272 647 1.0E-28
sp|Q9Y2R4|DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens GN=DDX52 PE=1 SV=3 272 647 1.0E-28
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 262 632 1.0E-28
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 267 644 1.0E-28
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 267 643 1.0E-28
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 256 654 2.0E-28
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 267 643 2.0E-28
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 267 644 2.0E-28
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 266 659 2.0E-28
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 267 643 2.0E-28
sp|Q9H8H2|DDX31_HUMAN Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2 267 650 2.0E-28
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 267 647 2.0E-28
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 267 647 2.0E-28
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 270 642 2.0E-28
sp|Q09775|ROK1_SCHPO ATP-dependent RNA helicase rok1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rok1 PE=3 SV=1 276 655 2.0E-28
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 264 644 2.0E-28
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 267 654 3.0E-28
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 291 648 3.0E-28
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 265 660 3.0E-28
sp|A5D7C1|DDX52_BOVIN Probable ATP-dependent RNA helicase DDX52 OS=Bos taurus GN=DDX52 PE=2 SV=1 272 647 3.0E-28
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 224 647 3.0E-28
sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 250 651 3.0E-28
sp|A1DE84|DBP7_NEOFI ATP-dependent RNA helicase dbp7 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp7 PE=3 SV=1 267 643 4.0E-28
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 267 644 4.0E-28
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 264 648 4.0E-28
sp|Q6NZQ2|DDX31_MOUSE Probable ATP-dependent RNA helicase DDX31 OS=Mus musculus GN=Ddx31 PE=2 SV=2 285 650 4.0E-28
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 265 659 4.0E-28
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 257 643 4.0E-28
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 265 660 4.0E-28
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 267 651 5.0E-28
sp|Q99PT0|DDX52_RAT Probable ATP-dependent RNA helicase DDX52 OS=Rattus norvegicus GN=Ddx52 PE=2 SV=1 267 647 5.0E-28
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 267 651 5.0E-28
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 267 644 5.0E-28
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 267 643 5.0E-28
sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 267 647 5.0E-28
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 270 644 6.0E-28
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 265 646 6.0E-28
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 272 652 6.0E-28
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 257 648 9.0E-28
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 267 676 9.0E-28
sp|Q3SZ40|DDX56_BOVIN Probable ATP-dependent RNA helicase DDX56 OS=Bos taurus GN=DDX56 PE=2 SV=1 257 649 1.0E-27
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 267 651 1.0E-27
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 267 651 1.0E-27
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 267 676 1.0E-27
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 267 647 1.0E-27
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 265 646 1.0E-27
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 267 651 1.0E-27
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 267 651 1.0E-27
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 267 651 1.0E-27
sp|A2RA55|DBP7_ASPNC ATP-dependent RNA helicase dbp7 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp7 PE=3 SV=1 267 643 2.0E-27
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 309 647 2.0E-27
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 267 651 2.0E-27
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 267 658 2.0E-27
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 259 643 2.0E-27
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 267 651 2.0E-27
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 309 648 2.0E-27
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 267 651 3.0E-27
sp|Q5BGX6|DBP7_EMENI ATP-dependent RNA helicase dbp7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp7 PE=3 SV=1 267 643 3.0E-27
sp|Q2UE66|DBP7_ASPOR ATP-dependent RNA helicase dbp7 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp7 PE=3 SV=1 267 650 3.0E-27
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 309 647 3.0E-27
sp|Q761Z9|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2 265 650 4.0E-27
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 267 643 4.0E-27
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 266 643 4.0E-27
sp|Q9NY93|DDX56_HUMAN Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens GN=DDX56 PE=1 SV=1 257 647 4.0E-27
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 267 647 5.0E-27
sp|P34668|YO12_CAEEL Putative ATP-dependent RNA helicase ZK686.2 OS=Caenorhabditis elegans GN=ZK686.2 PE=3 SV=2 284 659 6.0E-27
sp|A5DIX5|ROK1_PICGU ATP-dependent RNA helicase ROK1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ROK1 PE=3 SV=2 267 643 6.0E-27
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 240 644 6.0E-27
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 264 643 7.0E-27
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 267 643 8.0E-27
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 309 645 9.0E-27
sp|O60173|DBP7_SCHPO ATP-dependent RNA helicase dbp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp7 PE=3 SV=1 266 651 1.0E-26
sp|Q6AZV7|DDX55_XENLA ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1 278 650 1.0E-26
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP7 PE=3 SV=3 237 643 1.0E-26
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 272 649 1.0E-26
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 271 650 1.0E-26
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 309 647 1.0E-26
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 309 647 1.0E-26
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 267 632 1.0E-26
sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A OS=Triticum aestivum PE=2 SV=1 238 666 2.0E-26
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 265 652 2.0E-26
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 217 647 2.0E-26
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 262 648 2.0E-26
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 267 632 2.0E-26
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 309 639 2.0E-26
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 267 647 2.0E-26
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 265 673 3.0E-26
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 249 651 3.0E-26
sp|Q5ZLN8|DDX55_CHICK ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1 276 650 3.0E-26
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 267 651 3.0E-26
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 267 663 3.0E-26
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 309 647 3.0E-26
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 309 649 3.0E-26
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 309 648 3.0E-26
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 309 639 4.0E-26
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 267 643 4.0E-26
sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 267 650 4.0E-26
sp|A6RSH5|DBP7_BOTFB ATP-dependent RNA helicase dbp7 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp7 PE=3 SV=1 267 643 5.0E-26
sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A OS=Zea mays PE=2 SV=1 276 643 5.0E-26
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 267 643 5.0E-26
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 260 659 6.0E-26
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 267 673 6.0E-26
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 267 643 6.0E-26
sp|Q7XJN0|RH17_ARATH DEAD-box ATP-dependent RNA helicase 17 OS=Arabidopsis thaliana GN=RH17 PE=2 SV=1 267 651 7.0E-26
sp|Q9FFT9|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1 265 647 8.0E-26
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 309 647 8.0E-26
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 309 643 1.0E-25
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 264 644 1.0E-25
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 270 659 1.0E-25
sp|Q6C0X2|DHH1_YARLI ATP-dependent RNA helicase DHH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DHH1 PE=3 SV=1 264 644 1.0E-25
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 264 643 1.0E-25
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 267 644 1.0E-25
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 309 647 1.0E-25
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 316 644 1.0E-25
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 309 649 1.0E-25
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 309 649 2.0E-25
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 267 644 2.0E-25
sp|Q9FLB0|RH18_ARATH DEAD-box ATP-dependent RNA helicase 18 OS=Arabidopsis thaliana GN=RH18 PE=2 SV=1 266 653 2.0E-25
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 309 647 2.0E-25
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 267 643 2.0E-25
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 291 647 2.0E-25
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 309 647 2.0E-25
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 271 650 2.0E-25
sp|P0CR06|DBP10_CRYNJ ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP10 PE=3 SV=1 247 671 2.0E-25
sp|P0CR07|DBP10_CRYNB ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP10 PE=3 SV=1 247 671 2.0E-25
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 266 649 2.0E-25
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 271 650 2.0E-25
sp|P45818|ROK1_YEAST ATP-dependent RNA helicase ROK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROK1 PE=1 SV=1 169 627 2.0E-25
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 271 643 2.0E-25
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 257 648 2.0E-25
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 257 648 2.0E-25
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 257 648 2.0E-25
sp|A7TGW7|DBP10_VANPO ATP-dependent RNA helicase DBP10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP10 PE=3 SV=1 267 647 3.0E-25
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 266 687 3.0E-25
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 271 643 3.0E-25
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 267 647 3.0E-25
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 275 641 3.0E-25
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 309 648 4.0E-25
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 267 643 4.0E-25
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 267 643 4.0E-25
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 238 647 4.0E-25
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 264 643 4.0E-25
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 265 648 4.0E-25
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 267 643 4.0E-25
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 265 644 4.0E-25
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 264 643 5.0E-25
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 309 649 5.0E-25
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 309 649 5.0E-25
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 226 660 5.0E-25
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 266 647 5.0E-25
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 309 649 5.0E-25
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 264 653 6.0E-25
sp|Q5QYF8|RHLB_IDILO ATP-dependent RNA helicase RhlB OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rhlB PE=3 SV=1 266 669 6.0E-25
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 267 648 6.0E-25
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 276 649 6.0E-25
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 274 663 7.0E-25
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 271 650 8.0E-25
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 271 650 8.0E-25
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 267 645 9.0E-25
sp|A7F8V8|DBP7_SCLS1 ATP-dependent RNA helicase dbp7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp7 PE=3 SV=1 267 643 9.0E-25
sp|Q8JHJ2|DDX55_DANRE ATP-dependent RNA helicase DDX55 OS=Danio rerio GN=ddx55 PE=2 SV=2 272 650 9.0E-25
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 309 644 9.0E-25
sp|A1DMT9|MAK5_NEOFI ATP-dependent RNA helicase mak5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mak5 PE=3 SV=1 270 647 9.0E-25
sp|A7EAY2|MAK5_SCLS1 ATP-dependent RNA helicase mak5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mak5 PE=3 SV=1 269 659 9.0E-25
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 259 645 9.0E-25
sp|Q0DLB9|RH17_ORYSJ DEAD-box ATP-dependent RNA helicase 17 OS=Oryza sativa subsp. japonica GN=Os05g0110500 PE=2 SV=2 267 651 1.0E-24
sp|Q9VHU1|DDX55_DROME Probable ATP-dependent RNA helicase DDX55 homolog OS=Drosophila melanogaster GN=CG9630 PE=2 SV=1 272 650 1.0E-24
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 264 644 1.0E-24
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 264 653 1.0E-24
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 264 644 1.0E-24
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 264 644 1.0E-24
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 271 650 1.0E-24
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 274 648 1.0E-24
sp|Q4WMS3|MAK5_ASPFU ATP-dependent RNA helicase mak5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mak5 PE=3 SV=2 270 647 1.0E-24
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 267 650 1.0E-24
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 248 643 1.0E-24
sp|A6ZU15|ROK1_YEAS7 ATP-dependent RNA helicase ROK1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ROK1 PE=3 SV=1 169 627 1.0E-24
sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 270 642 2.0E-24
sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 267 651 2.0E-24
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 267 647 2.0E-24
sp|Q9DBN9|DDX59_MOUSE Probable ATP-dependent RNA helicase DDX59 OS=Mus musculus GN=Ddx59 PE=1 SV=1 267 675 2.0E-24
sp|Q58Z64|DHH1_CRYNH ATP-dependent RNA helicase VAD1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=VAD1 PE=2 SV=1 264 653 2.0E-24
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 267 647 2.0E-24
sp|P35683|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2 252 651 2.0E-24
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 266 687 2.0E-24
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 267 658 2.0E-24
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 225 651 3.0E-24
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 309 644 3.0E-24
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 309 639 3.0E-24
sp|Q6BLM5|DBP9_DEBHA ATP-dependent RNA helicase DBP9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP9 PE=3 SV=1 270 643 3.0E-24
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 309 649 3.0E-24
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 271 650 3.0E-24
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 267 648 4.0E-24
sp|Q0CI35|MAK5_ASPTN ATP-dependent RNA helicase mak5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mak5 PE=3 SV=2 270 676 4.0E-24
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 227 660 4.0E-24
sp|Q75AE1|ROK1_ASHGO ATP-dependent RNA helicase ROK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ROK1 PE=3 SV=1 238 627 4.0E-24
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 265 643 4.0E-24
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 265 643 4.0E-24
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 274 648 4.0E-24
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 265 642 4.0E-24
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 274 663 5.0E-24
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 274 648 5.0E-24
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 267 644 5.0E-24
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 244 644 5.0E-24
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 266 687 5.0E-24
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 264 642 6.0E-24
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 309 649 6.0E-24
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 309 649 6.0E-24
sp|Q8NHQ9|DDX55_HUMAN ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=3 275 650 7.0E-24
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 267 645 7.0E-24
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 267 650 7.0E-24
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 272 643 7.0E-24
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 267 676 7.0E-24
sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 258 643 7.0E-24
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 284 660 7.0E-24
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 274 663 8.0E-24
sp|A3LX02|SPB4_PICST ATP-dependent rRNA helicase SPB4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SPB4 PE=3 SV=2 276 688 8.0E-24
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 264 642 8.0E-24
sp|P41381|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1 274 666 8.0E-24
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 309 639 8.0E-24
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 309 649 9.0E-24
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 264 653 9.0E-24
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 309 649 9.0E-24
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 267 647 9.0E-24
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 309 644 1.0E-23
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 267 647 1.0E-23
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 265 642 1.0E-23
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 257 648 1.0E-23
sp|Q2UMY7|MAK5_ASPOR ATP-dependent RNA helicase mak5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mak5 PE=3 SV=1 270 637 1.0E-23
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 271 650 1.0E-23
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 267 676 1.0E-23
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 267 676 1.0E-23
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 267 676 1.0E-23
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 309 649 1.0E-23
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 264 663 1.0E-23
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 267 651 1.0E-23
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 309 644 1.0E-23
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 309 649 1.0E-23
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 309 643 1.0E-23
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 265 648 1.0E-23
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 264 644 1.0E-23
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 265 643 1.0E-23
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 264 644 1.0E-23
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 309 639 1.0E-23
sp|Q7S6F3|DBP9_NEUCR ATP-dependent RNA helicase dbp-9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-9 PE=3 SV=1 267 643 1.0E-23
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 309 639 1.0E-23
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 267 651 1.0E-23
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 265 642 2.0E-23
sp|A5DR68|MRH4_PICGU ATP-dependent RNA helicase MRH4, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MRH4 PE=3 SV=2 223 652 2.0E-23
sp|Q8SR01|DBP4_ENCCU ATP-dependent RNA helicase DBP4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP4 PE=3 SV=2 266 647 2.0E-23
sp|P0CQ80|DHH1_CRYNJ ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DHH1 PE=3 SV=1 264 653 2.0E-23
sp|P0CQ81|DHH1_CRYNB ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DHH1 PE=3 SV=1 264 653 2.0E-23
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 265 642 2.0E-23
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 265 642 2.0E-23
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 267 645 2.0E-23
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 264 678 2.0E-23
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 265 642 2.0E-23
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 265 642 2.0E-23
sp|Q81E85|CSHC_BACCR DEAD-box ATP-dependent RNA helicase CshC OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshC PE=2 SV=1 278 647 2.0E-23
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 267 644 2.0E-23
sp|Q5VRY0|RH39_ORYSJ DEAD-box ATP-dependent RNA helicase 39 OS=Oryza sativa subsp. japonica GN=Os01g0184500 PE=2 SV=1 267 643 2.0E-23
sp|Q8GXD6|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2 266 653 2.0E-23
sp|Q6ZPL9|DDX55_MOUSE ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=1 SV=2 275 650 2.0E-23
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 271 650 2.0E-23
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 264 653 2.0E-23
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 265 674 2.0E-23
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 265 674 2.0E-23
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 267 676 2.0E-23
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 291 647 2.0E-23
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 266 687 2.0E-23
sp|Q2NL08|DDX55_BOVIN ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=DDX55 PE=2 SV=1 275 650 3.0E-23
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 264 643 3.0E-23
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 258 653 3.0E-23
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 265 669 3.0E-23
sp|Q650T9|RH7_ORYSJ DEAD-box ATP-dependent RNA helicase 7 OS=Oryza sativa subsp. japonica GN=Os09g0520700 PE=2 SV=1 267 643 3.0E-23
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 272 647 3.0E-23
sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 258 643 4.0E-23
sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=1 SV=1 258 643 4.0E-23
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 265 642 4.0E-23
sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 258 643 4.0E-23
sp|Q39189|RH7_ARATH DEAD-box ATP-dependent RNA helicase 7 OS=Arabidopsis thaliana GN=RH7 PE=1 SV=2 272 642 4.0E-23
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 264 643 4.0E-23
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 271 643 4.0E-23
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 266 677 4.0E-23
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 265 642 4.0E-23
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 271 650 4.0E-23
sp|A3LZT3|DBP10_PICST ATP-dependent RNA helicase DBP10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP10 PE=3 SV=2 267 647 4.0E-23
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 267 648 5.0E-23
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 267 643 5.0E-23
sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 309 649 5.0E-23
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 309 649 6.0E-23
sp|Q56X76|RH39_ARATH DEAD-box ATP-dependent RNA helicase 39 OS=Arabidopsis thaliana GN=RH39 PE=2 SV=2 263 644 6.0E-23
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 309 649 6.0E-23
sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 258 643 6.0E-23
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 309 643 6.0E-23
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 290 647 7.0E-23
sp|Q5K5B6|RH57_ORYSJ DEAD-box ATP-dependent RNA helicase 57 OS=Oryza sativa subsp. japonica GN=Os07g0647900 PE=2 SV=2 255 658 7.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1956
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7987
Ophiocordyceps australis map64 (Brazil) OphauB2|7692 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04987
Ophiocordyceps camponoti-rufipedis Ophun1|3991
Ophiocordyceps kimflemingae Ophio5|4201
Ophiocordyceps subramaniannii Hirsu2|2108

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7692
MPVATTKLPPAAALATEPPAPAPAAGGFSYARYVPPRKPASNALEGDGAVAKRKLEADDEGAIKVKKSKTEQGNS
AAQDSGPKKKKNRRKRKQRTRGSECSDSSTVASGPKAAQDEVAELAQAIAAGQVASDADKGQVEGELGCVWERLK
WKECKEQAAVGSKKQQTEGQVGKKKREKKEEQAQWGADGWVRHKGLLERKEKALELASMMGQETSCETEAEAGQV
HGLEGLPQAVPVEGSEVAASYATLPAWLAAPMEVEEGLGRRFGDLGIASKVCKALEQRGISEAFAVQSAAIGLLL
PSSKRQAGDVLICASTGSGKTLGYGLPLMEDMSQGVVTRLRALVVLPTRELVKQAHEVLAFCAGAYQGTGRKTIR
VGMAAGNQSLRSEQDKLVSGERRYGGGDDVVEWASRVDVLVCTPGRLVEHVEQTAGFGLDDVRWLIVDEADKLLG
QSYQAWLGVVQARLGAVRKVIVSATLQRDVGLVSQLGLRRPTLLAMGDGAHRLPAGLREVAVRVADCSLKPLYLL
ALLRRHGLRHALVFTKSNEAALRLARLLALLDASLAPSLATMTSTTPTHQRRKTLRAFAEPEPALRLLLASDLVA
RGIDIAHLGHVINYDVPPTLAAYVHRVGRTARAARPGCAWTLVGDAESGWFWRCIGKTNHVARAAPVARLAVPDL
EPEAVARYHEALRCLGAEAHETRRP*
Coding >OphauB2|7692
ATGCCCGTGGCGACGACAAAGCTCCCGCCAGCGGCTGCCCTAGCGACAGAGCCCCCAGCTCCAGCTCCAGCAGCA
GGCGGCTTCAGCTATGCTCGCTATGTGCCGCCGCGCAAGCCAGCCAGCAATGCTCTCGAGGGTGATGGGGCAGTG
GCAAAACGAAAACTAGAGGCAGACGACGAAGGTGCAATCAAGGTTAAAAAATCAAAGACGGAGCAAGGCAACAGT
GCAGCTCAAGACAGCGGGCCGAAAAAGAAGAAGAATAGGAGGAAGCGCAAGCAAAGGACTCGTGGCAGCGAGTGT
AGCGATTCCTCGACGGTGGCTTCGGGGCCAAAGGCGGCGCAAGACGAGGTGGCAGAGTTGGCACAAGCAATAGCT
GCGGGCCAAGTGGCGTCAGACGCAGACAAGGGCCAAGTCGAGGGCGAATTGGGGTGTGTGTGGGAGAGGCTCAAG
TGGAAAGAGTGTAAAGAACAAGCAGCAGTGGGCAGCAAAAAGCAGCAGACAGAAGGACAAGTGGGCAAGAAGAAG
AGGGAAAAGAAGGAGGAGCAGGCTCAGTGGGGCGCAGATGGGTGGGTGCGGCACAAGGGACTTTTGGAGCGCAAG
GAAAAGGCTCTTGAGCTGGCGAGCATGATGGGGCAAGAGACGAGTTGCGAGACAGAGGCCGAGGCGGGCCAAGTA
CACGGGCTGGAAGGGCTGCCGCAAGCAGTGCCAGTGGAGGGGAGTGAGGTGGCGGCTAGCTACGCGACTCTGCCG
GCATGGCTGGCTGCGCCGATGGAGGTGGAGGAAGGGCTCGGGAGGCGGTTTGGCGACTTGGGCATTGCTAGCAAA
GTGTGCAAGGCTTTGGAACAAAGGGGCATTTCAGAAGCGTTTGCAGTGCAAAGCGCAGCGATTGGGCTGCTGCTG
CCAAGCAGCAAGAGACAGGCAGGGGATGTGTTGATATGTGCATCGACGGGCTCGGGCAAGACACTTGGCTACGGG
CTGCCGCTGATGGAGGACATGAGCCAGGGCGTGGTGACGAGGCTGCGGGCGCTGGTGGTGCTGCCGACGCGCGAA
CTGGTCAAGCAGGCGCACGAGGTGCTGGCCTTTTGCGCAGGCGCCTATCAAGGGACAGGGCGCAAGACGATCAGG
GTGGGCATGGCGGCTGGCAACCAGTCGCTGAGGAGCGAGCAGGACAAGCTGGTCTCGGGCGAGAGGCGCTATGGC
GGCGGAGACGACGTGGTGGAGTGGGCGTCGAGGGTGGACGTGCTGGTGTGCACGCCGGGGCGGCTGGTGGAGCAC
GTGGAGCAGACGGCGGGCTTTGGGCTCGACGACGTGAGGTGGTTGATTGTGGACGAGGCGGACAAGCTGCTGGGC
CAGAGCTACCAGGCGTGGCTGGGGGTGGTGCAGGCGCGGCTGGGGGCGGTGCGCAAGGTGATTGTCAGCGCGACG
CTGCAGCGCGACGTGGGGCTGGTGAGCCAGCTGGGGCTGCGGCGGCCCACGCTGCTGGCCATGGGCGACGGGGCG
CACCGGCTGCCGGCGGGGCTGCGCGAGGTGGCGGTGCGCGTGGCCGACTGCAGCCTCAAGCCGCTCTACCTGCTG
GCCCTGCTGCGCCGCCACGGCCTGCGCCACGCCCTCGTCTTCACCAAGAGCAACGAGGCGGCCCTGCGCCTGGCG
CGTCTGCTGGCCCTGCTGGATGCCAGCCTGGCGCCCAGCCTGGCCACCATGACTTCCACCACGCCCACCCACCAG
CGCCGCAAGACGTTGCGCGCCTTTGCCGAGCCCGAGCCCGCCCTGCGTCTGCTGCTGGCCTCGGATCTGGTGGCG
CGCGGCATCGACATTGCCCACCTGGGCCACGTCATCAACTACGACGTGCCTCCCACCCTGGCCGCCTATGTCCAT
CGTGTCGGCCGCACTGCCCGCGCCGCCCGCCCGGGCTGTGCCTGGACCCTTGTGGGCGACGCCGAGAGCGGCTGG
TTCTGGCGATGCATTGGCAAGACCAACCACGTGGCTAGGGCCGCTCCCGTTGCCCGCCTTGCCGTGCCCGACTTG
GAGCCAGAGGCCGTGGCTCGCTACCACGAGGCCCTGCGCTGCCTGGGGGCCGAGGCTCACGAGACGAGGCGCCCC
TAA
Transcript >OphauB2|7692
ATGCCCGTGGCGACGACAAAGCTCCCGCCAGCGGCTGCCCTAGCGACAGAGCCCCCAGCTCCAGCTCCAGCAGCA
GGCGGCTTCAGCTATGCTCGCTATGTGCCGCCGCGCAAGCCAGCCAGCAATGCTCTCGAGGGTGATGGGGCAGTG
GCAAAACGAAAACTAGAGGCAGACGACGAAGGTGCAATCAAGGTTAAAAAATCAAAGACGGAGCAAGGCAACAGT
GCAGCTCAAGACAGCGGGCCGAAAAAGAAGAAGAATAGGAGGAAGCGCAAGCAAAGGACTCGTGGCAGCGAGTGT
AGCGATTCCTCGACGGTGGCTTCGGGGCCAAAGGCGGCGCAAGACGAGGTGGCAGAGTTGGCACAAGCAATAGCT
GCGGGCCAAGTGGCGTCAGACGCAGACAAGGGCCAAGTCGAGGGCGAATTGGGGTGTGTGTGGGAGAGGCTCAAG
TGGAAAGAGTGTAAAGAACAAGCAGCAGTGGGCAGCAAAAAGCAGCAGACAGAAGGACAAGTGGGCAAGAAGAAG
AGGGAAAAGAAGGAGGAGCAGGCTCAGTGGGGCGCAGATGGGTGGGTGCGGCACAAGGGACTTTTGGAGCGCAAG
GAAAAGGCTCTTGAGCTGGCGAGCATGATGGGGCAAGAGACGAGTTGCGAGACAGAGGCCGAGGCGGGCCAAGTA
CACGGGCTGGAAGGGCTGCCGCAAGCAGTGCCAGTGGAGGGGAGTGAGGTGGCGGCTAGCTACGCGACTCTGCCG
GCATGGCTGGCTGCGCCGATGGAGGTGGAGGAAGGGCTCGGGAGGCGGTTTGGCGACTTGGGCATTGCTAGCAAA
GTGTGCAAGGCTTTGGAACAAAGGGGCATTTCAGAAGCGTTTGCAGTGCAAAGCGCAGCGATTGGGCTGCTGCTG
CCAAGCAGCAAGAGACAGGCAGGGGATGTGTTGATATGTGCATCGACGGGCTCGGGCAAGACACTTGGCTACGGG
CTGCCGCTGATGGAGGACATGAGCCAGGGCGTGGTGACGAGGCTGCGGGCGCTGGTGGTGCTGCCGACGCGCGAA
CTGGTCAAGCAGGCGCACGAGGTGCTGGCCTTTTGCGCAGGCGCCTATCAAGGGACAGGGCGCAAGACGATCAGG
GTGGGCATGGCGGCTGGCAACCAGTCGCTGAGGAGCGAGCAGGACAAGCTGGTCTCGGGCGAGAGGCGCTATGGC
GGCGGAGACGACGTGGTGGAGTGGGCGTCGAGGGTGGACGTGCTGGTGTGCACGCCGGGGCGGCTGGTGGAGCAC
GTGGAGCAGACGGCGGGCTTTGGGCTCGACGACGTGAGGTGGTTGATTGTGGACGAGGCGGACAAGCTGCTGGGC
CAGAGCTACCAGGCGTGGCTGGGGGTGGTGCAGGCGCGGCTGGGGGCGGTGCGCAAGGTGATTGTCAGCGCGACG
CTGCAGCGCGACGTGGGGCTGGTGAGCCAGCTGGGGCTGCGGCGGCCCACGCTGCTGGCCATGGGCGACGGGGCG
CACCGGCTGCCGGCGGGGCTGCGCGAGGTGGCGGTGCGCGTGGCCGACTGCAGCCTCAAGCCGCTCTACCTGCTG
GCCCTGCTGCGCCGCCACGGCCTGCGCCACGCCCTCGTCTTCACCAAGAGCAACGAGGCGGCCCTGCGCCTGGCG
CGTCTGCTGGCCCTGCTGGATGCCAGCCTGGCGCCCAGCCTGGCCACCATGACTTCCACCACGCCCACCCACCAG
CGCCGCAAGACGTTGCGCGCCTTTGCCGAGCCCGAGCCCGCCCTGCGTCTGCTGCTGGCCTCGGATCTGGTGGCG
CGCGGCATCGACATTGCCCACCTGGGCCACGTCATCAACTACGACGTGCCTCCCACCCTGGCCGCCTATGTCCAT
CGTGTCGGCCGCACTGCCCGCGCCGCCCGCCCGGGCTGTGCCTGGACCCTTGTGGGCGACGCCGAGAGCGGCTGG
TTCTGGCGATGCATTGGCAAGACCAACCACGTGGCTAGGGCCGCTCCCGTTGCCCGCCTTGCCGTGCCCGACTTG
GAGCCAGAGGCCGTGGCTCGCTACCACGAGGCCCTGCGCTGCCTGGGGGCCGAGGCTCACGAGACGAGGCGCCCC
TAA
Gene >OphauB2|7692
ATGCCCGTGGCGACGACAAAGCTCCCGCCAGCGGCTGCCCTAGCGACAGAGCCCCCAGCTCCAGCTCCAGCAGCA
GGCGGCTTCAGCTATGCTCGCTATGTGCCGCCGCGCAAGCCAGCCAGCAATGCTCTCGAGGGTGATGGGGCAGTG
GCAAAACGAAAACTAGAGGCAGACGACGAAGGTGCAATCAAGGTTAAAAAATCAAAGACGGAGCAAGGCAACAGT
GCAGCTCAAGACAGCGGGCCGAAAAAGAAGAAGAATAGGAGGAAGCGCAAGCAAAGGACTCGTGGCAGCGAGTGT
AGCGATTCCTCGACGGTGGCTTCGGGGCCAAAGGCGGCGCAAGACGAGGTGGCAGAGTTGGCACAAGCAATAGCT
GCGGGCCAAGTGGCGTCAGACGCAGACAAGGGCCAAGTCGAGGGCGAATTGGGGTGTGTGTGGGAGAGGCTCAAG
TGGAAAGAGTGTAAAGAACAAGCAGCAGTGGGCAGCAAAAAGCAGCAGACAGAAGGACAAGTGGGCAAGAAGAAG
AGGGAAAAGAAGGAGGAGCAGGCTCAGTGGGGCGCAGATGGGTGGGTGCGGCACAAGGGACTTTTGGAGCGCAAG
GAAAAGGCTCTTGAGCTGGCGAGCATGATGGGGCAAGAGACGAGTTGCGAGACAGAGGCCGAGGCGGGCCAAGTA
CACGGGCTGGAAGGGCTGCCGCAAGCAGTGCCAGTGGAGGGGAGTGAGGTGGCGGCTAGCTACGCGACTCTGCCG
GCATGGCTGGCTGCGCCGATGGAGGTGGAGGAAGGGCTCGGGAGGCGGTTTGGCGACTTGGGCATTGCTAGCAAA
GTGTGCAAGGCTTTGGAACAAAGGGGCATTTCAGAAGCGTTTGCAGTGCAAAGCGCAGCGATTGGGCTGCTGCTG
CCAAGCAGCAAGAGACAGGCAGGGGATGTGTTGATATGTGCATCGACGGGCTCGGGCAAGACACTTGGCTACGGG
CTGCCGCTGATGGAGGACATGAGCCAGGGCGTGGTGACGAGGCTGCGGGCGCTGGTGGTGCTGCCGACGCGCGAA
CTGGTCAAGCAGGCGCACGAGGTGCTGGCCTTTTGCGCAGGCGCCTATCAAGGGACAGGGCGCAAGACGATCAGG
GTGGGCATGGCGGCTGGCAACCAGTCGCTGAGGAGCGAGCAGGACAAGCTGGTCTCGGGCGAGAGGCGCTATGGC
GGCGGAGACGACGTGGTGGAGTGGGCGTCGAGGGTGGACGTGCTGGTGTGCACGCCGGGGCGGCTGGTGGAGCAC
GTGGAGCAGACGGCGGGCTTTGGGCTCGACGACGTGAGGTGGTTGATTGTGGACGAGGCGGACAAGCTGCTGGGC
CAGAGCTACCAGGCGTGGCTGGGGGTGGTGCAGGCGCGGCTGGGGGCGGTGCGCAAGGTGATTGTCAGCGCGACG
CTGCAGCGCGACGTGGGGCTGGTGAGCCAGCTGGGGCTGCGGCGGCCCACGCTGCTGGCCATGGGCGACGGGGCG
CACCGGCTGCCGGCGGGGCTGCGCGAGGTGGCGGTGCGCGTGGCCGACTGCAGCCTCAAGCCGCTCTACCTGCTG
GCCCTGCTGCGCCGCCACGGCCTGCGCCACGCCCTCGTCTTCACCAAGAGCAACGAGGCGGCCCTGCGCCTGGCG
CGTCTGCTGGCCCTGCTGGATGCCAGCCTGGCGCCCAGCCTGGCCACCATGACTTCCACCACGCCCACCCACCAG
CGCCGCAAGACGTTGCGCGCCTTTGCCGAGCCCGAGCCCGCCCTGCGTCTGCTGCTGGCCTCGGATCTGGTGGCG
CGCGGCATCGACATTGCCCACCTGGGCCACGTCATCAACTACGACGTGCCTCCCACCCTGGCCGCCTATGTCCAT
CGTGTCGGCCGCACTGCCCGCGCCGCCCGCCCGGGCTGTGCCTGGACCCTTGTGGGCGACGCCGAGAGCGGCTGG
TTCTGGCGATGCATTGGCAAGACCAACCACGTGGCTAGGGCCGCTCCCGTTGCCCGCCTTGCCGTGCCCGACTTG
GAGCCAGAGGCCGTGGCTCGCTACCACGAGGCCCTGCGCTGCCTGGGGGCCGAGGCTCACGAGACGAGGCGCCCC
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail