Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7680
Gene name
LocationContig_85:47641..48932
Strand+
Gene length (bp)1291
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain 1.9E-32 63 182
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 1.8E-18 32 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37382|RPB3_SCHPO DNA-directed RNA polymerase II subunit RPB3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb3 PE=1 SV=2 11 288 6.0E-107
sp|P16370|RPB3_YEAST DNA-directed RNA polymerase II subunit RPB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB3 PE=1 SV=2 16 275 3.0E-101
sp|Q3T0Q3|RPB3_BOVIN DNA-directed RNA polymerase II subunit RPB3 OS=Bos taurus GN=POLR2C PE=2 SV=1 17 275 8.0E-69
sp|P19387|RPB3_HUMAN DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens GN=POLR2C PE=1 SV=2 17 275 3.0E-68
sp|P97760|RPB3_MOUSE DNA-directed RNA polymerase II subunit RPB3 OS=Mus musculus GN=Polr2c PE=1 SV=1 17 275 2.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37382|RPB3_SCHPO DNA-directed RNA polymerase II subunit RPB3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb3 PE=1 SV=2 11 288 6.0E-107
sp|P16370|RPB3_YEAST DNA-directed RNA polymerase II subunit RPB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB3 PE=1 SV=2 16 275 3.0E-101
sp|Q3T0Q3|RPB3_BOVIN DNA-directed RNA polymerase II subunit RPB3 OS=Bos taurus GN=POLR2C PE=2 SV=1 17 275 8.0E-69
sp|P19387|RPB3_HUMAN DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens GN=POLR2C PE=1 SV=2 17 275 3.0E-68
sp|P97760|RPB3_MOUSE DNA-directed RNA polymerase II subunit RPB3 OS=Mus musculus GN=Polr2c PE=1 SV=1 17 275 2.0E-62
sp|Q39211|NRPB3_ARATH DNA-directed RNA polymerases II, IV and V subunit 3 OS=Arabidopsis thaliana GN=NRPB3 PE=1 SV=1 11 271 4.0E-56
sp|Q54DH7|RPB3_DICDI DNA-directed RNA polymerase II subunit rpb3 OS=Dictyostelium discoideum GN=polr2c PE=3 SV=1 17 268 3.0E-54
sp|Q39212|RPD3B_ARATH DNA-directed RNA polymerases IV and V subunit 3B OS=Arabidopsis thaliana GN=NRPD3B PE=1 SV=2 11 271 7.0E-50
sp|P16925|CNJC_TETTH Conjugation stage-specific protein OS=Tetrahymena thermophila GN=CNJC PE=2 SV=1 19 271 3.0E-40
sp|P07703|RPAC1_YEAST DNA-directed RNA polymerases I and III subunit RPAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC40 PE=1 SV=1 19 267 2.0E-27
sp|Q2NFZ6|RPOD_METST DNA-directed RNA polymerase subunit D OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpoD PE=3 SV=1 20 272 7.0E-27
sp|O26144|RPOD_METTH DNA-directed RNA polymerase subunit D OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoD PE=3 SV=1 32 267 6.0E-26
sp|Q8TVB8|RPOD_METKA DNA-directed RNA polymerase subunit D OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpoD PE=3 SV=1 25 275 2.0E-25
sp|Q32L22|RPAC1_BOVIN DNA-directed RNA polymerases I and III subunit RPAC1 OS=Bos taurus GN=POLR1C PE=2 SV=1 19 276 1.0E-22
sp|O59303|RPOD_PYRHO DNA-directed RNA polymerase subunit D OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoD PE=3 SV=2 19 275 1.0E-21
sp|O15160|RPAC1_HUMAN DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens GN=POLR1C PE=1 SV=1 19 276 2.0E-21
sp|Q9V198|RPOD_PYRAB DNA-directed RNA polymerase subunit D OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoD PE=3 SV=1 19 275 2.0E-20
sp|P52432|RPAC1_MOUSE DNA-directed RNA polymerases I and III subunit RPAC1 OS=Mus musculus GN=Polr1c PE=1 SV=3 19 276 7.0E-20
sp|O94616|RPAC1_SCHPO DNA-directed RNA polymerases I and III subunit RPAC1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc40 PE=3 SV=1 11 275 2.0E-19
sp|B1YC30|RPOD_PYRNV DNA-directed RNA polymerase subunit D OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpoD PE=3 SV=1 40 287 3.0E-19
sp|O28002|RPOD_ARCFU DNA-directed RNA polymerase subunit D OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoD PE=3 SV=1 17 194 4.0E-19
sp|Q8U0E4|RPOD_PYRFU DNA-directed RNA polymerase subunit D OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoD PE=3 SV=1 19 275 1.0E-18
sp|A1RSE3|RPOD_PYRIL DNA-directed RNA polymerase subunit D OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpoD PE=3 SV=1 40 275 4.0E-18
sp|Q5JJF4|RPOD_THEKO DNA-directed RNA polymerase subunit D OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoD PE=1 SV=1 19 267 5.0E-18
sp|Q57648|RPOD_METJA DNA-directed RNA polymerase subunit D OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoD PE=1 SV=1 39 276 5.0E-18
sp|Q8PV16|RPOD_METMA DNA-directed RNA polymerase subunit D OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoD PE=3 SV=1 19 276 6.0E-18
sp|Q97B93|RPOD_THEVO DNA-directed RNA polymerase subunit D OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpoD PE=3 SV=1 19 275 6.0E-18
sp|Q54SN4|RPAC1_DICDI DNA-directed RNA polymerases I and III subunit rpac1 OS=Dictyostelium discoideum GN=polr1c PE=3 SV=1 16 276 1.0E-17
sp|P0CG28|RPOD_METAC DNA-directed RNA polymerase subunit D OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoD PE=3 SV=1 19 276 2.0E-17
sp|Q9YB53|RPOD_AERPE DNA-directed RNA polymerase subunit D OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpoD PE=3 SV=2 20 276 3.0E-17
sp|Q8ZYQ3|RPOD_PYRAE DNA-directed RNA polymerase subunit D OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpoD PE=3 SV=1 40 278 5.0E-17
sp|Q9HJD9|RPOD_THEAC DNA-directed RNA polymerase subunit D OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoD PE=3 SV=1 20 275 2.0E-16
sp|Q6KZP5|RPOD_PICTO DNA-directed RNA polymerase subunit D OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpoD PE=3 SV=1 30 275 6.0E-16
sp|A3MXZ5|RPOD_PYRCJ DNA-directed RNA polymerase subunit D OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpoD PE=3 SV=1 40 275 1.0E-15
sp|A5UN55|RPOD_METS3 DNA-directed RNA polymerase subunit D OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpoD PE=3 SV=1 19 273 2.0E-15
sp|A4WNA4|RPOD_PYRAR DNA-directed RNA polymerase subunit D OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpoD PE=3 SV=1 40 283 4.0E-14
sp|Q96YW0|RPOD_SULTO DNA-directed RNA polymerase subunit D OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoD PE=3 SV=1 39 276 5.0E-14
sp|P95989|RPOD_SULSO DNA-directed RNA polymerase subunit D OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoD PE=1 SV=1 20 275 5.0E-14
sp|P39471|RPOD_SULAC DNA-directed RNA polymerase subunit D OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoD PE=3 SV=2 29 276 1.0E-13
sp|C3N8R8|RPOD_SULIY DNA-directed RNA polymerase subunit D OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoD PE=3 SV=1 20 275 5.0E-13
sp|C3NMQ0|RPOD_SULIN DNA-directed RNA polymerase subunit D OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoD PE=3 SV=1 20 275 5.0E-13
sp|C3MJP7|RPOD_SULIL DNA-directed RNA polymerase subunit D OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoD PE=3 SV=1 20 275 5.0E-13
sp|C3MZ05|RPOD_SULIM DNA-directed RNA polymerase subunit D OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoD PE=3 SV=1 20 275 5.0E-13
sp|C4KJ93|RPOD_SULIK DNA-directed RNA polymerase subunit D OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoD PE=3 SV=1 20 275 5.0E-13
sp|C3N054|RPOD_SULIA DNA-directed RNA polymerase subunit D OS=Sulfolobus islandicus (strain M.16.27) GN=rpoD PE=3 SV=1 20 275 5.0E-13
sp|Q00813|RPOD_HALMA DNA-directed RNA polymerase subunit D OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpoD PE=3 SV=1 40 271 2.0E-12
sp|Q3IQT6|RPOD_NATPD DNA-directed RNA polymerase subunit D OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpoD PE=3 SV=1 16 257 5.0E-11
sp|Q9HQJ4|RPOD_HALSA DNA-directed RNA polymerase subunit D OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoD PE=3 SV=1 20 191 4.0E-08
sp|B0R4Y2|RPOD_HALS3 DNA-directed RNA polymerase subunit D OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoD PE=3 SV=1 20 191 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0046983 protein dimerization activity Yes
GO:0009059 macromolecule biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005515 protein binding No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7680
MEGMDYDPMVMDGEPEQPQVKISAADSSRVDFELSQTNLSFANSLRRIMQAEVPTIAIDLVEVEINTSVLADEFI
AHRLGLIPLNSKGVTELNYSRDCDCEQYCEQCSVTLTLHAKCSSDEIMKVYARDLVIDGRHASSVGSPVVSDPDG
LGCLLAKLRKGQELKLSCIAKKGIAKEHAKWMPTSAVGFEYDPHNKLHHLDMWFENNTDPVKEWPKSKYADWEEP
LQEGEPFNYDAQPDRFYFEVETSGTMEPDQIVQGGIRALQQKIGALLKGLDPRKYGGDEADFDGPRSPDVNMDGG
TTPWQDQGYTTPYGGNTTSYGGGNTSYGGGGTSYGTGSGTAYGGGASTSYGSGSASYSGGGTSYGGGGGGAAGSY
GSTTPYNQNSWS*
Coding >OphauB2|7680
ATGGAAGGCATGGACTATGATCCCATGGTGATGGATGGGGAGCCTGAGCAGCCCCAGGTCAAGATATCGGCGGCT
GATAGCTCTCGCGTCGACTTTGAGCTATCACAGACAAATCTGTCCTTTGCAAATTCTCTACGGCGCATTATGCAG
GCTGAAGTGCCAACAATAGCTATTGATCTGGTCGAGGTTGAAATCAACACATCGGTACTAGCAGACGAATTTATT
GCTCACCGTCTTGGCCTCATACCACTCAACTCAAAAGGCGTCACTGAACTCAATTACTCGCGCGACTGCGACTGC
GAACAGTACTGCGAACAGTGCAGCGTCACTCTGACACTGCATGCCAAATGTTCGAGCGACGAAATCATGAAAGTT
TACGCCCGCGACTTGGTCATTGATGGGCGCCACGCCAGCTCGGTTGGAAGTCCTGTAGTCTCGGATCCAGACGGC
CTTGGCTGCCTGTTAGCCAAGCTTCGGAAAGGCCAAGAACTCAAGCTCTCGTGCATAGCCAAAAAAGGTATCGCA
AAGGAGCATGCCAAATGGATGCCCACATCTGCCGTTGGCTTCGAGTACGACCCACATAACAAACTGCACCATCTC
GACATGTGGTTTGAGAACAATACAGATCCCGTCAAAGAATGGCCCAAGAGCAAGTATGCCGACTGGGAAGAGCCC
TTGCAGGAGGGCGAGCCTTTCAACTATGATGCCCAGCCAGACCGCTTCTATTTTGAGGTGGAGACGTCAGGAACA
ATGGAACCCGATCAAATCGTACAAGGAGGGATAAGAGCCCTTCAACAGAAGATCGGTGCTCTGCTCAAAGGTCTT
GACCCGCGGAAATATGGCGGCGACGAGGCCGACTTTGATGGACCCCGCAGCCCTGACGTCAATATGGATGGTGGT
ACGACTCCTTGGCAAGATCAAGGCTACACGACTCCATATGGCGGCAATACAACGTCTTACGGAGGTGGCAACACT
TCGTATGGAGGCGGAGGAACCTCTTACGGCACGGGGTCTGGAACTGCATACGGCGGGGGCGCTAGCACTTCATAC
GGAAGCGGAAGTGCCTCATACAGCGGAGGAGGCACGTCGTACGGAGGGGGGGGAGGCGGAGCTGCGGGATCATAT
GGGAGCACCACGCCCTACAACCAGAACTCGTGGAGCTGA
Transcript >OphauB2|7680
ATGGAAGGCATGGACTATGATCCCATGGTGATGGATGGGGAGCCTGAGCAGCCCCAGGTCAAGATATCGGCGGCT
GATAGCTCTCGCGTCGACTTTGAGCTATCACAGACAAATCTGTCCTTTGCAAATTCTCTACGGCGCATTATGCAG
GCTGAAGTGCCAACAATAGCTATTGATCTGGTCGAGGTTGAAATCAACACATCGGTACTAGCAGACGAATTTATT
GCTCACCGTCTTGGCCTCATACCACTCAACTCAAAAGGCGTCACTGAACTCAATTACTCGCGCGACTGCGACTGC
GAACAGTACTGCGAACAGTGCAGCGTCACTCTGACACTGCATGCCAAATGTTCGAGCGACGAAATCATGAAAGTT
TACGCCCGCGACTTGGTCATTGATGGGCGCCACGCCAGCTCGGTTGGAAGTCCTGTAGTCTCGGATCCAGACGGC
CTTGGCTGCCTGTTAGCCAAGCTTCGGAAAGGCCAAGAACTCAAGCTCTCGTGCATAGCCAAAAAAGGTATCGCA
AAGGAGCATGCCAAATGGATGCCCACATCTGCCGTTGGCTTCGAGTACGACCCACATAACAAACTGCACCATCTC
GACATGTGGTTTGAGAACAATACAGATCCCGTCAAAGAATGGCCCAAGAGCAAGTATGCCGACTGGGAAGAGCCC
TTGCAGGAGGGCGAGCCTTTCAACTATGATGCCCAGCCAGACCGCTTCTATTTTGAGGTGGAGACGTCAGGAACA
ATGGAACCCGATCAAATCGTACAAGGAGGGATAAGAGCCCTTCAACAGAAGATCGGTGCTCTGCTCAAAGGTCTT
GACCCGCGGAAATATGGCGGCGACGAGGCCGACTTTGATGGACCCCGCAGCCCTGACGTCAATATGGATGGTGGT
ACGACTCCTTGGCAAGATCAAGGCTACACGACTCCATATGGCGGCAATACAACGTCTTACGGAGGTGGCAACACT
TCGTATGGAGGCGGAGGAACCTCTTACGGCACGGGGTCTGGAACTGCATACGGCGGGGGCGCTAGCACTTCATAC
GGAAGCGGAAGTGCCTCATACAGCGGAGGAGGCACGTCGTACGGAGGGGGGGGAGGCGGAGCTGCGGGATCATAT
GGGAGCACCACGCCCTACAACCAGAACTCGTGGAGCTGA
Gene >OphauB2|7680
ATGGAAGGCATGGACTATGATCCCATGGTGATGGATGGGGAGCCTGAGCAGCCCCAGGTCAAGATATCGGCGGTA
CGCAGAACCTATGTCTAAAACGCCTTCGCTGCTTCCTGGGTCTGATTGAAGCATATTTCGACAGGCTGATAGCTC
TCGCGTCGACTTTGAGCTATCACAGACAAATCTGTCCTTTGCAAATTCTCTACGGCGCATTATGCAGGCTGAAGT
GCCAACAATAGCTATTGATCTGGTCGAGGTTGAAATCAACACATCGGTACTAGCAGACGAATTTATTGCTCACCG
TCTTGGCCTCATACCACTCAACTCAAAAGGCGTCACTGAACTCAATTACTCGCGCGACTGCGACTGCGAACAGTA
CTGCGAACAGTGCAGCGTCACTCTGACACTGCATGCCAAATGTTCGAGCGACGAAATCATGAAAGTTTACGCCCG
CGACTTGGTCATTGATGGGCGCCACGCCAGCTCGGTTGGAAGTCCTGTAGTCTCGGATCCAGACGGCCTTGGCTG
CCTGTTAGCCAAGCTTCGGAAAGGCCAAGAACTCAAGCTCTCGTGCATAGCCAAAAAAGGTATCGCAAAGGAGCA
TGCCAAATGGATGCCCACATCTGCCGTTGGCTTCGAGTACGACCCACATAACAAACTGCACCATCTCGACATGTG
GTTTGAGAACAATACAGATCCCGTCAAAGAATGGTGCGTTGCTATATCGTCTACGAGGCGCTTCAAATAGCTATG
CTAACTAACATGGGGCAGGCCCAAGAGCAAGTATGCCGACTGGGAAGAGCCCTTGCAGGAGGGCGAGCCTTTCAA
CTATGATGCCCAGCCAGACCGCTTCTATTTTGAGGTGGAGACGTCAGGAACAATGGAACCCGATCAAATCGTACA
AGGAGGGATAAGAGCCCTTCAACAGAAGATCGGTGCTCTGCTCAAAGGTCTTGACCCGCGGAAATATGGCGGCGA
CGAGGCCGACTTTGATGGACCCCGCAGCCCTGACGTCAATATGGATGGTGGTACGACTCCTTGGCAAGATCAAGG
CTACACGACTCCATATGGCGGCAATACAACGTCTTACGGAGGTGGCAACACTTCGTATGGAGGCGGAGGAACCTC
TTACGGCACGGGGTCTGGAACTGCATACGGCGGGGGCGCTAGCACTTCATACGGAAGCGGAAGTGCCTCATACAG
CGGAGGAGGCACGTCGTACGGAGGGGGGGGAGGCGGAGCTGCGGGATCATATGGGAGCACCACGCCCTACAACCA
GAACTCGTGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail