Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7677
Gene name
LocationContig_85:40770..43154
Strand+
Gene length (bp)2384
Transcript length (bp)1992
Coding sequence length (bp)1992
Protein length (aa) 664

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 8.3E-18 140 194
PF01591 6PF2K 6-phosphofructo-2-kinase 6.2E-45 243 407
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 9.1E-24 494 637

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 64 650 3.0E-146
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 69 650 4.0E-141
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 118 656 3.0E-108
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 146 654 2.0E-79
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 114 631 1.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 64 650 3.0E-146
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 69 650 4.0E-141
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 118 656 3.0E-108
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 146 654 2.0E-79
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 114 631 1.0E-76
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 114 631 4.0E-75
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 146 638 3.0E-73
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 125 631 5.0E-73
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 146 640 2.0E-72
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 241 632 6.0E-70
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 241 632 8.0E-70
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 241 631 8.0E-70
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 145 638 3.0E-68
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 248 631 2.0E-67
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 245 638 5.0E-67
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 246 631 1.0E-66
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 248 631 5.0E-65
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 245 631 5.0E-65
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 248 631 5.0E-65
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 245 631 1.0E-64
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 245 631 8.0E-64
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 245 631 1.0E-63
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 245 631 1.0E-63
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 248 631 4.0E-63
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 245 631 6.0E-62
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 273 630 2.0E-43
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 96 630 1.0E-31
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 261 415 1.0E-10
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 146 188 9.0E-10
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 146 188 1.0E-09
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 146 188 1.0E-09
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 146 188 6.0E-09
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 146 188 6.0E-09
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 115 191 8.0E-09
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 124 191 1.0E-08
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 146 188 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0006000 fructose metabolic process Yes
GO:0005524 ATP binding Yes
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008443 phosphofructokinase activity No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0044238 primary metabolic process No
GO:0019318 hexose metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0019200 carbohydrate kinase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3907
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4122
Ophiocordyceps australis map64 (Brazil) OphauB2|7677 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00493
Ophiocordyceps camponoti-rufipedis Ophun1|6505
Ophiocordyceps kimflemingae Ophio5|8196
Ophiocordyceps subramaniannii Hirsu2|7784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7677
MPAAVVIPQQVGQKQAKQSSLAKLVMNNNLALSSSPSVSLTSRQHDQHLSVQPPPPRNGVLSHDSPSAPMAQAVR
ILHDLTDTPLSQSVNSTAPNSPRMPPQRQNSGSQTPRVRPHATTLNIPGMTRSRVSPDGRIPQRDVAAKLVIVMV
GLPARGKSYITKKLQRYLSWQQHDSRVFNVGNRRRNAVGIKVSRKPKLAPEPDRLDPPVQAATILLNGVPGQECT
EPPELHLDGPCTSTCQAVDQSAKFFDPTNEQASALRNQVAMQTLEELLDYLLVQGGAVGILDATNSTIKRRQQIV
DRIKAREPKLGILFIESICHDENLLEANMRLKLSGPDYRDKDPTQSLEDFKSRVAAYASAYQTLGKYEEDNDMQY
IQMVDVGRKLVQHRLRGFLSGGISTYLSSFNLAPRQIWITRHGQSVDNELGKLGGNSPITERGHCYGLALYKFIT
QRRKEWLMEQKSKIAQATFPPHPGDNTPPYPDMNHDLEQKNFCVWTSMLQRSVETAEYFDVDDDYDVKNWEMLNE
LNAGQFEGMTYEEIAQKYPEEFRKRSRDKLNYIYPGVGGEGYLQVISRLRDMVREIERITDHVLIIGHRSVCRVL
MAYFMDLTREDITDMDVPLGMLYSIEPKPYGIAFHAYKYDEARGWFDELPNYKPQKAGAIHPL*
Coding >OphauB2|7677
ATGCCGGCCGCCGTCGTCATCCCCCAGCAAGTCGGGCAGAAACAGGCAAAGCAATCGTCGCTGGCAAAACTTGTC
ATGAACAACAATCTCGCTCTCTCATCGTCGCCTTCAGTCTCGCTCACGTCTCGTCAACACGACCAACATTTATCT
GTCCAGCCGCCACCGCCCCGCAATGGAGTTCTTTCTCACGACTCCCCGTCTGCGCCCATGGCACAGGCTGTGCGA
ATTCTGCACGACTTGACCGACACACCATTGTCCCAGAGCGTCAACTCGACTGCACCAAACTCGCCGCGCATGCCT
CCACAGCGCCAAAATTCGGGCAGCCAGACGCCTCGAGTTCGCCCACATGCCACAACGCTCAATATTCCCGGCATG
ACGCGCTCCCGAGTTTCTCCCGACGGCCGCATCCCACAGCGCGATGTCGCTGCTAAACTCGTCATTGTCATGGTG
GGCCTGCCCGCTCGCGGCAAGTCTTACATTACAAAGAAGCTGCAGCGTTACCTATCCTGGCAGCAGCACGACTCG
CGCGTCTTCAACGTTGGCAACCGCCGTCGCAATGCCGTCGGCATCAAGGTTTCCCGTAAACCAAAGCTGGCGCCT
GAACCCGATCGCCTCGACCCCCCAGTCCAGGCTGCCACGATTCTGCTCAATGGCGTTCCTGGCCAGGAATGCACT
GAGCCCCCGGAACTACACCTCGACGGCCCTTGCACTTCTACATGTCAAGCTGTTGACCAGTCGGCCAAGTTTTTC
GATCCCACTAATGAGCAGGCTTCTGCCCTGAGGAATCAGGTGGCTATGCAGACACTTGAAGAGCTACTCGACTAC
CTGCTTGTTCAGGGCGGTGCCGTTGGCATTCTCGACGCTACAAACAGCACCATCAAGCGCCGACAGCAAATCGTT
GATCGTATCAAGGCTCGCGAACCCAAGCTTGGCATCCTCTTTATCGAGAGCATCTGCCACGACGAGAACCTGCTC
GAGGCCAATATGCGCCTCAAGCTCTCAGGCCCTGACTATCGCGACAAGGACCCCACCCAGTCGCTTGAAGATTTT
AAGAGTCGCGTTGCAGCATATGCCAGCGCCTACCAAACTCTGGGTAAATACGAGGAGGACAATGACATGCAGTAC
ATTCAGATGGTTGACGTGGGTCGAAAGCTCGTACAGCATCGGCTTAGGGGCTTTCTCAGCGGCGGCATCAGCACC
TACCTGTCGAGTTTCAATCTTGCTCCGCGGCAGATTTGGATCACGCGTCATGGCCAAAGCGTGGACAATGAGCTC
GGCAAGCTGGGTGGCAATTCGCCCATTACTGAGCGCGGCCATTGCTACGGCTTGGCTCTGTACAAATTCATCACC
CAGCGGCGAAAGGAATGGCTCATGGAGCAAAAGAGTAAGATCGCCCAGGCCACGTTTCCGCCCCATCCGGGCGAC
AACACGCCTCCGTATCCAGACATGAATCACGACCTCGAGCAGAAAAATTTCTGTGTCTGGACATCGATGCTTCAG
CGCAGCGTCGAGACGGCCGAGTATTTTGATGTCGACGATGACTATGATGTCAAGAATTGGGAGATGCTCAATGAG
CTCAACGCTGGCCAGTTTGAGGGCATGACGTACGAGGAGATTGCTCAAAAGTACCCCGAGGAATTTCGCAAGCGG
TCGCGCGACAAGCTCAACTACATATACCCTGGTGTCGGTGGCGAAGGTTACCTGCAGGTAATCAGCCGCCTCCGT
GACATGGTGCGTGAGATTGAGCGCATCACAGACCACGTCCTTATTATAGGACACCGCTCCGTCTGCCGCGTGCTC
ATGGCCTATTTCATGGACCTGACACGCGAAGACATTACCGACATGGATGTCCCTCTTGGCATGCTCTATTCCATT
GAGCCCAAGCCATATGGTATCGCATTTCATGCCTACAAGTATGACGAGGCCCGAGGATGGTTTGATGAATTGCCC
AATTATAAACCTCAGAAAGCGGGTGCGATTCACCCTCTATAG
Transcript >OphauB2|7677
ATGCCGGCCGCCGTCGTCATCCCCCAGCAAGTCGGGCAGAAACAGGCAAAGCAATCGTCGCTGGCAAAACTTGTC
ATGAACAACAATCTCGCTCTCTCATCGTCGCCTTCAGTCTCGCTCACGTCTCGTCAACACGACCAACATTTATCT
GTCCAGCCGCCACCGCCCCGCAATGGAGTTCTTTCTCACGACTCCCCGTCTGCGCCCATGGCACAGGCTGTGCGA
ATTCTGCACGACTTGACCGACACACCATTGTCCCAGAGCGTCAACTCGACTGCACCAAACTCGCCGCGCATGCCT
CCACAGCGCCAAAATTCGGGCAGCCAGACGCCTCGAGTTCGCCCACATGCCACAACGCTCAATATTCCCGGCATG
ACGCGCTCCCGAGTTTCTCCCGACGGCCGCATCCCACAGCGCGATGTCGCTGCTAAACTCGTCATTGTCATGGTG
GGCCTGCCCGCTCGCGGCAAGTCTTACATTACAAAGAAGCTGCAGCGTTACCTATCCTGGCAGCAGCACGACTCG
CGCGTCTTCAACGTTGGCAACCGCCGTCGCAATGCCGTCGGCATCAAGGTTTCCCGTAAACCAAAGCTGGCGCCT
GAACCCGATCGCCTCGACCCCCCAGTCCAGGCTGCCACGATTCTGCTCAATGGCGTTCCTGGCCAGGAATGCACT
GAGCCCCCGGAACTACACCTCGACGGCCCTTGCACTTCTACATGTCAAGCTGTTGACCAGTCGGCCAAGTTTTTC
GATCCCACTAATGAGCAGGCTTCTGCCCTGAGGAATCAGGTGGCTATGCAGACACTTGAAGAGCTACTCGACTAC
CTGCTTGTTCAGGGCGGTGCCGTTGGCATTCTCGACGCTACAAACAGCACCATCAAGCGCCGACAGCAAATCGTT
GATCGTATCAAGGCTCGCGAACCCAAGCTTGGCATCCTCTTTATCGAGAGCATCTGCCACGACGAGAACCTGCTC
GAGGCCAATATGCGCCTCAAGCTCTCAGGCCCTGACTATCGCGACAAGGACCCCACCCAGTCGCTTGAAGATTTT
AAGAGTCGCGTTGCAGCATATGCCAGCGCCTACCAAACTCTGGGTAAATACGAGGAGGACAATGACATGCAGTAC
ATTCAGATGGTTGACGTGGGTCGAAAGCTCGTACAGCATCGGCTTAGGGGCTTTCTCAGCGGCGGCATCAGCACC
TACCTGTCGAGTTTCAATCTTGCTCCGCGGCAGATTTGGATCACGCGTCATGGCCAAAGCGTGGACAATGAGCTC
GGCAAGCTGGGTGGCAATTCGCCCATTACTGAGCGCGGCCATTGCTACGGCTTGGCTCTGTACAAATTCATCACC
CAGCGGCGAAAGGAATGGCTCATGGAGCAAAAGAGTAAGATCGCCCAGGCCACGTTTCCGCCCCATCCGGGCGAC
AACACGCCTCCGTATCCAGACATGAATCACGACCTCGAGCAGAAAAATTTCTGTGTCTGGACATCGATGCTTCAG
CGCAGCGTCGAGACGGCCGAGTATTTTGATGTCGACGATGACTATGATGTCAAGAATTGGGAGATGCTCAATGAG
CTCAACGCTGGCCAGTTTGAGGGCATGACGTACGAGGAGATTGCTCAAAAGTACCCCGAGGAATTTCGCAAGCGG
TCGCGCGACAAGCTCAACTACATATACCCTGGTGTCGGTGGCGAAGGTTACCTGCAGGTAATCAGCCGCCTCCGT
GACATGGTGCGTGAGATTGAGCGCATCACAGACCACGTCCTTATTATAGGACACCGCTCCGTCTGCCGCGTGCTC
ATGGCCTATTTCATGGACCTGACACGCGAAGACATTACCGACATGGATGTCCCTCTTGGCATGCTCTATTCCATT
GAGCCCAAGCCATATGGTATCGCATTTCATGCCTACAAGTATGACGAGGCCCGAGGATGGTTTGATGAATTGCCC
AATTATAAACCTCAGAAAGCGGGTGCGATTCACCCTCTATAG
Gene >OphauB2|7677
ATGCCGGCCGCCGTCGTCATCCCCCAGCAAGGTGAGTGTGTGTCTGTTCCAACTTTCTTTCTTCCTTCCATGTTT
CTGTAATCAACTTCTTGCTACGCTGCGCAATATATCCATTATTGCCATCCCTCCTTCATCCCTGAGTCTTCGTCG
CTACCTCGTTCCGTCTTCCCTCCTTCCCGTCGTGCCACCAAGAAAAAAATTTCCCCTGTGGGAGGGGCCAAAGTT
TAAAAAAAAAAAAAAAACACACACAAGTCGCTCGCTTCCAAGATTCATCTCACTCACGCTTCTTCTCCCTCTCGA
CTAGTCGGGCAGAAACAGGCAAAGCAATCGTCGCTGGCAAAACTTGTCATGAACAACAATCTCGCTCTCTCATCG
TCGCCTTCAGTCTCGCTCACGTCTCGTCAACACGACCAACATTTATCTGTCCAGCCGCCACCGCCCCGCAATGGA
GTTCTTTCTCACGACTCCCCGTCTGCGCCCATGGCACAGGCTGTGCGAATTCTGCACGACTTGACCGACACACCA
TTGTCCCAGAGCGTCAACTCGACTGCACCAAACTCGCCGCGCATGTAGGTACCTCTACTGCCGTCCTCTACTCTT
GCGTCGTGCTGACGCCATCAAGGCCTCCACAGCGCCAAAATTCGGGCAGCCAGACGCCTCGAGTTCGCCCACATG
CCACAACGCTCAATATTCCCGGCATGACGCGCTCCCGAGTTTCTCCCGACGGCCGCATCCCACAGCGCGATGTCG
CTGCTAAACTCGTCATTGTCATGGTGGGCCTGCCCGCTCGCGGCAAGTCTTACATTACAAAGAAGCTGCAGCGTT
ACCTATCCTGGCAGCAGCACGACTCGCGCGTCTTCAACGTTGGCAACCGCCGTCGCAATGCCGTCGGCATCAAGG
TTTCCCGTAAACCAAAGCTGGCGCCTGAACCCGATCGCCTCGACCCCCCAGTCCAGGCTGCCACGATTCTGCTCA
ATGGCGTTCCTGGCCAGGAATGCACTGAGCCCCCGGAACTACACCTCGACGGCCCTTGCACTTCTACATGTCAAG
CTGTTGACCAGTCGGCCAAGTTTTTCGATCCCACTAATGAGCAGGCTTCTGCCCTGAGGAATCAGGTGGCTATGC
AGACACTTGAAGAGCTACTCGACTACCTGCTTGTTCAGGGCGGTGCCGTTGGCATTCTCGACGCTACAAACAGCA
CCATCAAGCGCCGACAGCAAATCGTTGATCGTATCAAGGCTCGCGAACCCAAGCTTGGCATCCTCTTTATCGAGA
GCATCTGCCACGACGAGAACCTGCTCGAGGCCAATATGCGCCTCAAGCTCTCAGGCCCTGACTATCGCGACAAGG
ACCCCACCCAGTCGCTTGAAGATTTTAAGAGTCGCGTTGCAGCATATGCCAGCGCCTACCAAACTCTGGGTAAAT
ACGAGGAGGACAATGACATGCAGTACATTCAGGTTCGCCCCGTTCCACTCTCCCCGTCGCACGACCAAGTACATA
CCGGCCTAACTAGCTCAACGCAGATGGTTGACGTGGGTCGAAAGCTCGTACAGCATCGGCTTAGGGGCTTTCTCA
GCGGCGGCATCAGCACCTACCTGTCGAGTTTCAATCTTGCTCCGCGGCAGATTTGGATCACGCGTCATGGCCAAA
GCGTGGACAATGAGCTCGGCAAGCTGGGTGGCAATTCGCCCATTACTGAGCGCGGCCATTGCTACGGCTTGGCTC
TGTACAAATTCATCACCCAGCGGCGAAAGGAATGGCTCATGGAGCAAAAGAGTAAGATCGCCCAGGCCACGTTTC
CGCCCCATCCGGGCGACAACACGCCTCCGTATCCAGACATGAATCACGACCTCGAGCAGAAAAATTTCTGTGTCT
GGACATCGATGCTTCAGCGCAGCGTCGAGACGGCCGAGTATTTTGATGTCGACGATGACTATGATGTCAAGAATT
GGGAGATGCTCAATGAGCTCAACGCTGGCCAGTTTGAGGGCATGACGTACGAGGAGATTGCTCAAAAGTACCCCG
AGGAATTTCGCAAGCGGTCGCGCGACAAGCTCAACTACATATACCCTGGTGTCGGTGGCGAAGGTTACCTGCAGG
TAATCAGCCGCCTCCGTGACATGGTGCGTGAGATTGAGCGCATCACAGACCACGTCCTTATTATAGGACACCGCT
CCGTCTGCCGCGTGCTCATGGCCTATTTCATGGACCTGACACGCGAAGACATTACCGACATGGATGTCCCTCTTG
GCATGCTCTATTCCATTGAGCCCAAGCCATATGGTATCGCATTTCATGCCTACAAGTATGACGAGGCCCGAGGAT
GGTTTGATGAATTGCCCAATTATAAACCTCAGAAAGCGGGTGCGATTCACCCTCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail