Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7667
Gene name
LocationContig_85:5746..6277
Strand-
Gene length (bp)531
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09649 CHZ Histone chaperone domain CHZ 4.0E-16 66 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2GNS7|CHZ1_CHAGB Histone H2A.Z-specific chaperone CHZ1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHZ1 PE=3 SV=2 71 102 8.0E-08
sp|Q0C807|CHZ1_ASPTN Histone H2A.Z-specific chaperone chz1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=chz1 PE=3 SV=1 69 122 5.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5951
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3260
Ophiocordyceps australis map64 (Brazil) OphauB2|7667 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00485
Ophiocordyceps camponoti-rufipedis Ophun1|2054
Ophiocordyceps kimflemingae Ophio5|7092

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7667
MAEKSTSATLPADTSKATESSFAESKGKGKAVAEDVARDESLDDEDDDDEDEDDEDDGDENIEGGDDEDGMEEID
LDNIITNGRRTRGTKIDFVKAAEENPADEEDDDEDDDFQPSHEDTEMSG*
Coding >OphauB2|7667
ATGGCGGAAAAAAGCACCTCTGCTACCCTCCCTGCCGACACTTCCAAGGCAACCGAGTCAAGCTTTGCCGAGAGC
AAGGGAAAGGGCAAGGCTGTTGCCGAGGACGTGGCTCGTGACGAGAGTCTCGATGACGAAGATGATGACGATGAA
GATGAAGATGACGAGGACGATGGCGACGAAAACATTGAGGGCGGCGATGACGAGGACGGCATGGAAGAGATTGAC
CTCGATAACATCATCACCAATGGTCGTCGCACCCGCGGCACCAAGATTGACTTTGTCAAGGCTGCCGAGGAAAAT
CCTGCAGACGAAGAAGACGATGATGAGGATGACGACTTTCAGCCAAGCCACGAGGACACTGAGATGTCGGGCTAG
Transcript >OphauB2|7667
ATGGCGGAAAAAAGCACCTCTGCTACCCTCCCTGCCGACACTTCCAAGGCAACCGAGTCAAGCTTTGCCGAGAGC
AAGGGAAAGGGCAAGGCTGTTGCCGAGGACGTGGCTCGTGACGAGAGTCTCGATGACGAAGATGATGACGATGAA
GATGAAGATGACGAGGACGATGGCGACGAAAACATTGAGGGCGGCGATGACGAGGACGGCATGGAAGAGATTGAC
CTCGATAACATCATCACCAATGGTCGTCGCACCCGCGGCACCAAGATTGACTTTGTCAAGGCTGCCGAGGAAAAT
CCTGCAGACGAAGAAGACGATGATGAGGATGACGACTTTCAGCCAAGCCACGAGGACACTGAGATGTCGGGCTAG
Gene >OphauB2|7667
ATGGCGGAAAAAAGCACCTCTGCTACCCTCCCTGCCGACACTTCCAAGGCAACCGAGTCAAGCTTTGCCGAGAGC
AAGGGAAAGGGCAAGGCTGTTGCCGAGGACGTGGCTCGTGACGAGAGTCTCGATGACGAAGATGATGACGATGAA
GATGAAGATGACGAGGACGATGGCGACGAAGTATGTGAGCCCAAGCAGAACACAAGCGTGCCTAGTCTATAGCAA
ATGGAAACGCTTAAGGACTTGCTCAAGGACTAACATCGAGACTATAGAACATTGAGGGCGGTGAATAACACCCAG
GGCATTATTCCTGTATCCATGTGTCACCAGGTATTGACTTGCTATACAGGCGATGACGAGGACGGCATGGAAGAG
ATTGACCTCGATAACATCATCACCAATGGTCGTCGCACCCGCGGCACCAAGATTGACTTTGTCAAGGCTGCCGAG
GAAAATCCTGCAGACGAAGAAGACGATGATGAGGATGACGACTTTCAGCCAAGCCACGAGGACACTGAGATGTCG
GGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail