Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7661
Gene name
LocationContig_84:72169..74458
Strand+
Gene length (bp)2289
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 1.2E-13 525 588
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.8E-02 287 305
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 4.7E-04 311 330
PF01713 Smr Smr domain 1.9E-07 600 656

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 514 642 8.0E-17
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 282 347 6.0E-09
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 282 347 7.0E-09
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 525 667 3.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3100
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6085
Ophiocordyceps australis map64 (Brazil) OphauB2|7661 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00405
Ophiocordyceps camponoti-rufipedis Ophun1|3977
Ophiocordyceps kimflemingae Ophio5|6347
Ophiocordyceps subramaniannii Hirsu2|54

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7661
MISDEHYELCLPILQDPNLEDEDKTDRLEIALKDETGLTGSSLENIILDALWRYREVGGGSTSPPPIRPSILRRP
SPASWRGSPTPLPGSPRLGVSPLAPAGYISSTLNRAKSSTASPFSSPRASPRLALATPVIPHSPNLNAYEFASDP
TPPTEILGDYQMENVEWLVNDDAASVSSSVGASSSALNAAAPEFSSLSSQQTDMSPYDMLRSILGQTRTDHEIEA
ALSLHGYDLSATITSIMESQPIDGVNMATANEEPKGVLIGKSIMADARPATPLGQQKSGVVCKFYMSTGQCLRAD
CRFSHDLSNYLCKYWVMGNCLAGDTCIFSHDPTNLMGKLGLDEAEAGTSKNDGLDDGNWFPALQPETSGTKGSSA
GGACSSVSLGAPPPGPRHMQGTESPRLRSRPGSRQQVKNNPMSAPAMDDNEAFPSLGAALSKQGKKHHGKRGGHG
HGHKENLVPSSLADIVKRTPSPAPGPSLQWEPRRAGMNGSAAAPRSGENSAAALAIPGPKHIPWLETGEWANKSY
LKARQDAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHRDAARELYQKRNKTGVNSGSEIFV
DLHGLHAEEAVEYLEKVLLENSREARPIYAITGTGHHSKNGKDKVGRTVRGFLNEWRYAYREFSVPGDRNNMGGI
LGIDARSWDKSLGRFEEEEPDILSQGVEIGDGKVRLLVRDAAKGPGSRR*
Coding >OphauB2|7661
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCCATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACTGGCCTCACGGGCTCGTCGCTGGAAAATATCATTCTTGACGCC
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATTCGCCCATCAATCCTTCGCCGACCT
TCTCCGGCGTCATGGCGCGGGTCGCCAACACCTCTGCCGGGATCCCCGCGACTCGGCGTGAGTCCGCTTGCGCCG
GCCGGATACATATCATCTACACTCAACAGAGCAAAATCGTCGACAGCATCTCCCTTTTCCTCTCCACGGGCATCT
CCGCGCCTAGCTCTTGCGACTCCAGTGATACCGCACAGTCCGAATCTCAATGCCTACGAATTTGCTTCGGATCCT
ACTCCACCCACGGAAATACTGGGCGACTATCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGTTGGCGCCTCTTCTAGCGCCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATATGACATGCTTCGTTCTATTCTCGGCCAGACGAGGACCGACCACGAGATAGAAGCC
GCTCTATCGCTACATGGCTACGATCTTAGTGCAACGATAACCTCGATAATGGAGAGTCAGCCTATTGATGGTGTA
AACATGGCCACAGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCGATTATGGCTGACGCACGTCCTGCA
ACACCTCTTGGACAGCAAAAGTCTGGTGTCGTGTGCAAATTCTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTTAGTCACGATCTGAGCAACTACTTGTGCAAGTACTGGGTCATGGGCAACTGTCTCGCAGGCGACACT
TGCATCTTCTCACATGATCCAACCAACCTGATGGGCAAATTGGGGCTGGATGAGGCAGAGGCGGGTACGAGCAAG
AATGATGGGCTCGATGATGGTAACTGGTTCCCAGCTCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCAGCT
GGAGGAGCATGTTCGAGTGTCTCATTGGGCGCTCCACCGCCGGGCCCCCGACACATGCAGGGCACCGAGAGTCCC
CGCCTGAGGTCGCGGCCAGGCAGCAGACAACAGGTCAAGAACAACCCCATGTCTGCTCCGGCCATGGATGACAAC
GAAGCCTTCCCGTCTCTGGGAGCGGCCTTGTCCAAGCAAGGCAAGAAACACCATGGCAAACGAGGCGGGCACGGC
CATGGCCACAAAGAGAACCTGGTGCCTAGTTCACTGGCGGACATTGTCAAGAGGACGCCGTCTCCTGCACCAGGA
CCGTCGCTGCAATGGGAGCCGAGAAGAGCGGGAATGAATGGAAGCGCTGCGGCGCCGCGTAGCGGAGAGAATAGC
GCGGCGGCTTTGGCAATTCCCGGCCCGAAGCATATCCCGTGGCTGGAGACGGGCGAGTGGGCCAATAAGTCGTAT
CTCAAAGCTCGCCAAGACGCCATTAAGCACGGCGGTCTCCGCAACAAGTTCTTGCAAAGTGCGGCACAGGCATGG
AACCGGAACGACGCCAGAGCGGCAAAGGCGCTCAGTCTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCG
CATCGTGACGCCGCTCGAGAGTTGTACCAAAAGCGCAACAAGACGGGCGTGAACAGCGGAAGCGAGATTTTCGTC
GACTTGCACGGACTACATGCGGAAGAAGCAGTTGAATATCTGGAAAAGGTGCTGCTTGAGAATAGTCGCGAGGCT
CGACCCATCTATGCCATTACAGGGACGGGACATCATAGCAAGAACGGCAAGGACAAGGTTGGCAGGACGGTGCGC
GGCTTTCTCAATGAGTGGCGCTATGCCTACCGCGAGTTCTCGGTCCCAGGCGACCGCAACAACATGGGGGGCATT
CTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTTGGGCGCTTTGAGGAGGAGGAACCCGACATTCTCAGCCAG
GGGGTGGAGATTGGCGATGGCAAGGTGCGGCTTCTGGTACGAGATGCGGCCAAGGGCCCAGGCAGCCGGCGATGA
Transcript >OphauB2|7661
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCCATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACTGGCCTCACGGGCTCGTCGCTGGAAAATATCATTCTTGACGCC
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATTCGCCCATCAATCCTTCGCCGACCT
TCTCCGGCGTCATGGCGCGGGTCGCCAACACCTCTGCCGGGATCCCCGCGACTCGGCGTGAGTCCGCTTGCGCCG
GCCGGATACATATCATCTACACTCAACAGAGCAAAATCGTCGACAGCATCTCCCTTTTCCTCTCCACGGGCATCT
CCGCGCCTAGCTCTTGCGACTCCAGTGATACCGCACAGTCCGAATCTCAATGCCTACGAATTTGCTTCGGATCCT
ACTCCACCCACGGAAATACTGGGCGACTATCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGTTGGCGCCTCTTCTAGCGCCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATATGACATGCTTCGTTCTATTCTCGGCCAGACGAGGACCGACCACGAGATAGAAGCC
GCTCTATCGCTACATGGCTACGATCTTAGTGCAACGATAACCTCGATAATGGAGAGTCAGCCTATTGATGGTGTA
AACATGGCCACAGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCGATTATGGCTGACGCACGTCCTGCA
ACACCTCTTGGACAGCAAAAGTCTGGTGTCGTGTGCAAATTCTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTTAGTCACGATCTGAGCAACTACTTGTGCAAGTACTGGGTCATGGGCAACTGTCTCGCAGGCGACACT
TGCATCTTCTCACATGATCCAACCAACCTGATGGGCAAATTGGGGCTGGATGAGGCAGAGGCGGGTACGAGCAAG
AATGATGGGCTCGATGATGGTAACTGGTTCCCAGCTCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCAGCT
GGAGGAGCATGTTCGAGTGTCTCATTGGGCGCTCCACCGCCGGGCCCCCGACACATGCAGGGCACCGAGAGTCCC
CGCCTGAGGTCGCGGCCAGGCAGCAGACAACAGGTCAAGAACAACCCCATGTCTGCTCCGGCCATGGATGACAAC
GAAGCCTTCCCGTCTCTGGGAGCGGCCTTGTCCAAGCAAGGCAAGAAACACCATGGCAAACGAGGCGGGCACGGC
CATGGCCACAAAGAGAACCTGGTGCCTAGTTCACTGGCGGACATTGTCAAGAGGACGCCGTCTCCTGCACCAGGA
CCGTCGCTGCAATGGGAGCCGAGAAGAGCGGGAATGAATGGAAGCGCTGCGGCGCCGCGTAGCGGAGAGAATAGC
GCGGCGGCTTTGGCAATTCCCGGCCCGAAGCATATCCCGTGGCTGGAGACGGGCGAGTGGGCCAATAAGTCGTAT
CTCAAAGCTCGCCAAGACGCCATTAAGCACGGCGGTCTCCGCAACAAGTTCTTGCAAAGTGCGGCACAGGCATGG
AACCGGAACGACGCCAGAGCGGCAAAGGCGCTCAGTCTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCG
CATCGTGACGCCGCTCGAGAGTTGTACCAAAAGCGCAACAAGACGGGCGTGAACAGCGGAAGCGAGATTTTCGTC
GACTTGCACGGACTACATGCGGAAGAAGCAGTTGAATATCTGGAAAAGGTGCTGCTTGAGAATAGTCGCGAGGCT
CGACCCATCTATGCCATTACAGGGACGGGACATCATAGCAAGAACGGCAAGGACAAGGTTGGCAGGACGGTGCGC
GGCTTTCTCAATGAGTGGCGCTATGCCTACCGCGAGTTCTCGGTCCCAGGCGACCGCAACAACATGGGGGGCATT
CTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTTGGGCGCTTTGAGGAGGAGGAACCCGACATTCTCAGCCAG
GGGGTGGAGATTGGCGATGGCAAGGTGCGGCTTCTGGTACGAGATGCGGCCAAGGGCCCAGGCAGCCGGCGATGA
Gene >OphauB2|7661
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCCATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACTGGCCTCACGGGCTCGTCGCTGGAAAATATCATTCTTGACGCC
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATTCGCCCATCAATCCTTCGCCGACCT
TCTCCGGCGTCATGGCGCGGGTCGCCAACACCTCTGCCGGGATCCCCGCGACTCGGCGTGAGTCCGCTTGCGCCG
GCCGGATACATATCATCTACACTCAACAGAGCAAAATCGTCGACAGCATCTCCCTTTTCCTCTCCACGGGCATCT
CCGCGCCTAGCTCTTGCGACTCCAGTGATACCGCACAGTCCGAATCTCAATGCCTACGAATTTGCTTCGGATCCT
ACTCCACCCACGGAAATACTGGGCGACTATCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGTTGGCGCCTCTTCTAGCGCCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATATGACATGCTTCGTTCTATTCTCGGCCAGACGAGGACCGACCACGAGATAGAAGCC
GCTCTATCGCTACATGGCTACGATCTTAGTGCAACGATAACCTCGATAATGGAGAGTCAGCCTATTGATGGTGTA
AACATGGCCACAGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCGATTATGGCTGACGCACGTCCTGCA
ACACCTCTTGGACAGCAAAAGTCTGGTGTCGTGTGCAAATTCTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTTAGTCACGATCTGAGCAACTACTTGTGCAAGTAAGTTGAAGTCGTTTTGGCTGTTGGCTGCGGCAGC
TTGCTAACAGCGTCTTACCCAGGTACTGGGTCATGGGCAACTGTCTCGCAGGCGACACTTGCATCTTCTCACATG
ATCCAACCAACCTGATGGGCAAATTGGGGCTGGATGAGGCAGAGGCGGGTACGAGCAAGAATGATGGGCTCGATG
ATGGTAACTGGTTCCCAGCTCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCAGCTGGAGGAGCATGTTCGA
GTGTCTCATTGGGCGCTCCACCGCCGGGCCCCCGACACATGCAGGGCACCGAGAGTCCCCGCCTGAGGTCGCGGC
CAGGCAGCAGACAACAGGTCAAGAACAACCCCATGTCTGCTCCGGCCATGGATGACAACGAAGCCTTCCCGTCTC
TGGGAGCGGCCTTGTCCAAGCAAGGCAAGAAACACCATGGCAAACGAGGCGGGCACGGCCATGGCCACAAAGAGA
ACCTGGTGCCTAGTTCACTGGCGGACATTGTCAAGAGGACGCCGTCTCCTGCACCAGGACCGTCGCTGCAATGGG
AGCCGAGAAGAGCGGGAATGAATGGAAGCGCTGCGGCGCCGCGTAGCGGAGAGAATAGCGCGGCGGCTTTGGCAA
TTCCCGGCCCGAAGCATATCCCGTGGCTGGAGACGGGCGAGTGGGCCAATAAGTCGTATCTCAAAGCTCGCCAAG
ACGCCATTAAGCACGGCGGTCTCCGCAACAAGTTCTTGCAAAGGTCAGTGGGAGTCGCCTTGCTTATTGGACTTG
GGGTTAACACTAGATGGGGATAGTGCGGCACAGGCATGGAACCGGAACGACGCCAGAGCGGCAAAGGCGCTCAGT
CTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCGCATCGTGACGCCGCTCGAGAGTTGTACCAAAAGCGC
AACAAGACGGGCGTGAACAGCGGAAGCGAGATTTTCGTCGACTTGCACGGACTACATGCGGAAGAAGCAGTTGAA
TATCTGGAAAAGGTGCTGCTTGAGAATAGTCGCGAGGCTCGACCCATCTATGCCATTACAGGGACGGGACATCAT
AGCAAGAACGGCAAGGACAAGGTTGGCAGGACGGTGCGCGGCTTTCTCAATGAGTGGCGCTATGCCTACCGCGAG
TTCTCGGTCCCAGGCGACCGCAACAACATGGGGGGCATTCTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTT
GGGCGCTTTGAGGAGGAGGAACCCGACATTCTCAGCCAGGGGGTGGAGATTGGCGATGGCAAGGTGCGGCTTCTG
GTACGAGATGCGGCCAAGGGCCCAGGCAGCCGGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail