Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7661
Gene name
LocationContig_84:72169..74458
Strand+
Gene length (bp)2289
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 1.2E-13 525 588
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.8E-02 287 305
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 4.7E-04 311 330
PF01713 Smr Smr domain 1.9E-07 600 656

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 514 642 8.0E-17
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 282 347 6.0E-09
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 282 347 7.0E-09
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 525 667 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7661
MISDEHYELCLPILQDPNLEDEDKTDRLEIALKDETGLTGSSLENIILDALWRYREVGGGSTSPPPIRPSILRRP
SPASWRGSPTPLPGSPRLGVSPLAPAGYISSTLNRAKSSTASPFSSPRASPRLALATPVIPHSPNLNAYEFASDP
TPPTEILGDYQMENVEWLVNDDAASVSSSVGASSSALNAAAPEFSSLSSQQTDMSPYDMLRSILGQTRTDHEIEA
ALSLHGYDLSATITSIMESQPIDGVNMATANEEPKGVLIGKSIMADARPATPLGQQKSGVVCKFYMSTGQCLRAD
CRFSHDLSNYLCKYWVMGNCLAGDTCIFSHDPTNLMGKLGLDEAEAGTSKNDGLDDGNWFPALQPETSGTKGSSA
GGACSSVSLGAPPPGPRHMQGTESPRLRSRPGSRQQVKNNPMSAPAMDDNEAFPSLGAALSKQGKKHHGKRGGHG
HGHKENLVPSSLADIVKRTPSPAPGPSLQWEPRRAGMNGSAAAPRSGENSAAALAIPGPKHIPWLETGEWANKSY
LKARQDAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHRDAARELYQKRNKTGVNSGSEIFV
DLHGLHAEEAVEYLEKVLLENSREARPIYAITGTGHHSKNGKDKVGRTVRGFLNEWRYAYREFSVPGDRNNMGGI
LGIDARSWDKSLGRFEEEEPDILSQGVEIGDGKVRLLVRDAAKGPGSRR*
Coding >OphauB2|7661
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCCATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACTGGCCTCACGGGCTCGTCGCTGGAAAATATCATTCTTGACGCC
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATTCGCCCATCAATCCTTCGCCGACCT
TCTCCGGCGTCATGGCGCGGGTCGCCAACACCTCTGCCGGGATCCCCGCGACTCGGCGTGAGTCCGCTTGCGCCG
GCCGGATACATATCATCTACACTCAACAGAGCAAAATCGTCGACAGCATCTCCCTTTTCCTCTCCACGGGCATCT
CCGCGCCTAGCTCTTGCGACTCCAGTGATACCGCACAGTCCGAATCTCAATGCCTACGAATTTGCTTCGGATCCT
ACTCCACCCACGGAAATACTGGGCGACTATCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGTTGGCGCCTCTTCTAGCGCCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATATGACATGCTTCGTTCTATTCTCGGCCAGACGAGGACCGACCACGAGATAGAAGCC
GCTCTATCGCTACATGGCTACGATCTTAGTGCAACGATAACCTCGATAATGGAGAGTCAGCCTATTGATGGTGTA
AACATGGCCACAGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCGATTATGGCTGACGCACGTCCTGCA
ACACCTCTTGGACAGCAAAAGTCTGGTGTCGTGTGCAAATTCTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTTAGTCACGATCTGAGCAACTACTTGTGCAAGTACTGGGTCATGGGCAACTGTCTCGCAGGCGACACT
TGCATCTTCTCACATGATCCAACCAACCTGATGGGCAAATTGGGGCTGGATGAGGCAGAGGCGGGTACGAGCAAG
AATGATGGGCTCGATGATGGTAACTGGTTCCCAGCTCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCAGCT
GGAGGAGCATGTTCGAGTGTCTCATTGGGCGCTCCACCGCCGGGCCCCCGACACATGCAGGGCACCGAGAGTCCC
CGCCTGAGGTCGCGGCCAGGCAGCAGACAACAGGTCAAGAACAACCCCATGTCTGCTCCGGCCATGGATGACAAC
GAAGCCTTCCCGTCTCTGGGAGCGGCCTTGTCCAAGCAAGGCAAGAAACACCATGGCAAACGAGGCGGGCACGGC
CATGGCCACAAAGAGAACCTGGTGCCTAGTTCACTGGCGGACATTGTCAAGAGGACGCCGTCTCCTGCACCAGGA
CCGTCGCTGCAATGGGAGCCGAGAAGAGCGGGAATGAATGGAAGCGCTGCGGCGCCGCGTAGCGGAGAGAATAGC
GCGGCGGCTTTGGCAATTCCCGGCCCGAAGCATATCCCGTGGCTGGAGACGGGCGAGTGGGCCAATAAGTCGTAT
CTCAAAGCTCGCCAAGACGCCATTAAGCACGGCGGTCTCCGCAACAAGTTCTTGCAAAGTGCGGCACAGGCATGG
AACCGGAACGACGCCAGAGCGGCAAAGGCGCTCAGTCTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCG
CATCGTGACGCCGCTCGAGAGTTGTACCAAAAGCGCAACAAGACGGGCGTGAACAGCGGAAGCGAGATTTTCGTC
GACTTGCACGGACTACATGCGGAAGAAGCAGTTGAATATCTGGAAAAGGTGCTGCTTGAGAATAGTCGCGAGGCT
CGACCCATCTATGCCATTACAGGGACGGGACATCATAGCAAGAACGGCAAGGACAAGGTTGGCAGGACGGTGCGC
GGCTTTCTCAATGAGTGGCGCTATGCCTACCGCGAGTTCTCGGTCCCAGGCGACCGCAACAACATGGGGGGCATT
CTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTTGGGCGCTTTGAGGAGGAGGAACCCGACATTCTCAGCCAG
GGGGTGGAGATTGGCGATGGCAAGGTGCGGCTTCTGGTACGAGATGCGGCCAAGGGCCCAGGCAGCCGGCGATGA
Transcript >OphauB2|7661
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCCATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACTGGCCTCACGGGCTCGTCGCTGGAAAATATCATTCTTGACGCC
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATTCGCCCATCAATCCTTCGCCGACCT
TCTCCGGCGTCATGGCGCGGGTCGCCAACACCTCTGCCGGGATCCCCGCGACTCGGCGTGAGTCCGCTTGCGCCG
GCCGGATACATATCATCTACACTCAACAGAGCAAAATCGTCGACAGCATCTCCCTTTTCCTCTCCACGGGCATCT
CCGCGCCTAGCTCTTGCGACTCCAGTGATACCGCACAGTCCGAATCTCAATGCCTACGAATTTGCTTCGGATCCT
ACTCCACCCACGGAAATACTGGGCGACTATCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGTTGGCGCCTCTTCTAGCGCCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATATGACATGCTTCGTTCTATTCTCGGCCAGACGAGGACCGACCACGAGATAGAAGCC
GCTCTATCGCTACATGGCTACGATCTTAGTGCAACGATAACCTCGATAATGGAGAGTCAGCCTATTGATGGTGTA
AACATGGCCACAGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCGATTATGGCTGACGCACGTCCTGCA
ACACCTCTTGGACAGCAAAAGTCTGGTGTCGTGTGCAAATTCTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTTAGTCACGATCTGAGCAACTACTTGTGCAAGTACTGGGTCATGGGCAACTGTCTCGCAGGCGACACT
TGCATCTTCTCACATGATCCAACCAACCTGATGGGCAAATTGGGGCTGGATGAGGCAGAGGCGGGTACGAGCAAG
AATGATGGGCTCGATGATGGTAACTGGTTCCCAGCTCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCAGCT
GGAGGAGCATGTTCGAGTGTCTCATTGGGCGCTCCACCGCCGGGCCCCCGACACATGCAGGGCACCGAGAGTCCC
CGCCTGAGGTCGCGGCCAGGCAGCAGACAACAGGTCAAGAACAACCCCATGTCTGCTCCGGCCATGGATGACAAC
GAAGCCTTCCCGTCTCTGGGAGCGGCCTTGTCCAAGCAAGGCAAGAAACACCATGGCAAACGAGGCGGGCACGGC
CATGGCCACAAAGAGAACCTGGTGCCTAGTTCACTGGCGGACATTGTCAAGAGGACGCCGTCTCCTGCACCAGGA
CCGTCGCTGCAATGGGAGCCGAGAAGAGCGGGAATGAATGGAAGCGCTGCGGCGCCGCGTAGCGGAGAGAATAGC
GCGGCGGCTTTGGCAATTCCCGGCCCGAAGCATATCCCGTGGCTGGAGACGGGCGAGTGGGCCAATAAGTCGTAT
CTCAAAGCTCGCCAAGACGCCATTAAGCACGGCGGTCTCCGCAACAAGTTCTTGCAAAGTGCGGCACAGGCATGG
AACCGGAACGACGCCAGAGCGGCAAAGGCGCTCAGTCTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCG
CATCGTGACGCCGCTCGAGAGTTGTACCAAAAGCGCAACAAGACGGGCGTGAACAGCGGAAGCGAGATTTTCGTC
GACTTGCACGGACTACATGCGGAAGAAGCAGTTGAATATCTGGAAAAGGTGCTGCTTGAGAATAGTCGCGAGGCT
CGACCCATCTATGCCATTACAGGGACGGGACATCATAGCAAGAACGGCAAGGACAAGGTTGGCAGGACGGTGCGC
GGCTTTCTCAATGAGTGGCGCTATGCCTACCGCGAGTTCTCGGTCCCAGGCGACCGCAACAACATGGGGGGCATT
CTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTTGGGCGCTTTGAGGAGGAGGAACCCGACATTCTCAGCCAG
GGGGTGGAGATTGGCGATGGCAAGGTGCGGCTTCTGGTACGAGATGCGGCCAAGGGCCCAGGCAGCCGGCGATGA
Gene >OphauB2|7661
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCCATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACTGGCCTCACGGGCTCGTCGCTGGAAAATATCATTCTTGACGCC
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATTCGCCCATCAATCCTTCGCCGACCT
TCTCCGGCGTCATGGCGCGGGTCGCCAACACCTCTGCCGGGATCCCCGCGACTCGGCGTGAGTCCGCTTGCGCCG
GCCGGATACATATCATCTACACTCAACAGAGCAAAATCGTCGACAGCATCTCCCTTTTCCTCTCCACGGGCATCT
CCGCGCCTAGCTCTTGCGACTCCAGTGATACCGCACAGTCCGAATCTCAATGCCTACGAATTTGCTTCGGATCCT
ACTCCACCCACGGAAATACTGGGCGACTATCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGTTGGCGCCTCTTCTAGCGCCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATATGACATGCTTCGTTCTATTCTCGGCCAGACGAGGACCGACCACGAGATAGAAGCC
GCTCTATCGCTACATGGCTACGATCTTAGTGCAACGATAACCTCGATAATGGAGAGTCAGCCTATTGATGGTGTA
AACATGGCCACAGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCGATTATGGCTGACGCACGTCCTGCA
ACACCTCTTGGACAGCAAAAGTCTGGTGTCGTGTGCAAATTCTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTTAGTCACGATCTGAGCAACTACTTGTGCAAGTAAGTTGAAGTCGTTTTGGCTGTTGGCTGCGGCAGC
TTGCTAACAGCGTCTTACCCAGGTACTGGGTCATGGGCAACTGTCTCGCAGGCGACACTTGCATCTTCTCACATG
ATCCAACCAACCTGATGGGCAAATTGGGGCTGGATGAGGCAGAGGCGGGTACGAGCAAGAATGATGGGCTCGATG
ATGGTAACTGGTTCCCAGCTCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCAGCTGGAGGAGCATGTTCGA
GTGTCTCATTGGGCGCTCCACCGCCGGGCCCCCGACACATGCAGGGCACCGAGAGTCCCCGCCTGAGGTCGCGGC
CAGGCAGCAGACAACAGGTCAAGAACAACCCCATGTCTGCTCCGGCCATGGATGACAACGAAGCCTTCCCGTCTC
TGGGAGCGGCCTTGTCCAAGCAAGGCAAGAAACACCATGGCAAACGAGGCGGGCACGGCCATGGCCACAAAGAGA
ACCTGGTGCCTAGTTCACTGGCGGACATTGTCAAGAGGACGCCGTCTCCTGCACCAGGACCGTCGCTGCAATGGG
AGCCGAGAAGAGCGGGAATGAATGGAAGCGCTGCGGCGCCGCGTAGCGGAGAGAATAGCGCGGCGGCTTTGGCAA
TTCCCGGCCCGAAGCATATCCCGTGGCTGGAGACGGGCGAGTGGGCCAATAAGTCGTATCTCAAAGCTCGCCAAG
ACGCCATTAAGCACGGCGGTCTCCGCAACAAGTTCTTGCAAAGGTCAGTGGGAGTCGCCTTGCTTATTGGACTTG
GGGTTAACACTAGATGGGGATAGTGCGGCACAGGCATGGAACCGGAACGACGCCAGAGCGGCAAAGGCGCTCAGT
CTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCGCATCGTGACGCCGCTCGAGAGTTGTACCAAAAGCGC
AACAAGACGGGCGTGAACAGCGGAAGCGAGATTTTCGTCGACTTGCACGGACTACATGCGGAAGAAGCAGTTGAA
TATCTGGAAAAGGTGCTGCTTGAGAATAGTCGCGAGGCTCGACCCATCTATGCCATTACAGGGACGGGACATCAT
AGCAAGAACGGCAAGGACAAGGTTGGCAGGACGGTGCGCGGCTTTCTCAATGAGTGGCGCTATGCCTACCGCGAG
TTCTCGGTCCCAGGCGACCGCAACAACATGGGGGGCATTCTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTT
GGGCGCTTTGAGGAGGAGGAACCCGACATTCTCAGCCAGGGGGTGGAGATTGGCGATGGCAAGGTGCGGCTTCTG
GTACGAGATGCGGCCAAGGGCCCAGGCAGCCGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail