Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7660
Gene name
LocationContig_84:69282..71029
Strand+
Gene length (bp)1747
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 3.4E-15 188 399
PF02373 JmjC JmjC domain, hydroxylase 8.0E-10 291 401
PF12937 F-box-like F-box-like 4.5E-06 63 106
PF00646 F-box F-box domain 9.2E-05 61 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q67XX3|FB252_ARATH F-box protein At5g06550 OS=Arabidopsis thaliana GN=At5g06550 PE=2 SV=1 34 475 3.0E-78
sp|Q9M9E8|FB92_ARATH F-box protein At1g78280 OS=Arabidopsis thaliana GN=At1g78280 PE=2 SV=3 52 402 2.0E-50
sp|Q9VD28|JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster GN=PSR PE=2 SV=1 123 405 4.0E-38
sp|Q6PFM0|JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio GN=jmjd6 PE=2 SV=2 153 402 5.0E-37
sp|Q9GYI4|JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans GN=psr-1 PE=1 SV=2 151 401 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q67XX3|FB252_ARATH F-box protein At5g06550 OS=Arabidopsis thaliana GN=At5g06550 PE=2 SV=1 34 475 3.0E-78
sp|Q9M9E8|FB92_ARATH F-box protein At1g78280 OS=Arabidopsis thaliana GN=At1g78280 PE=2 SV=3 52 402 2.0E-50
sp|Q9VD28|JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster GN=PSR PE=2 SV=1 123 405 4.0E-38
sp|Q6PFM0|JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio GN=jmjd6 PE=2 SV=2 153 402 5.0E-37
sp|Q9GYI4|JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans GN=psr-1 PE=1 SV=2 151 401 1.0E-35
sp|Q6GND3|JMD6A_XENLA Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-A OS=Xenopus laevis GN=jmjd6-a PE=2 SV=1 155 402 1.0E-35
sp|Q58DS6|JMJD6_BOVIN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Bos taurus GN=JMJD6 PE=2 SV=1 148 402 2.0E-35
sp|Q5R6G2|JMJD6_PONAB Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Pongo abelii GN=JMJD6 PE=2 SV=1 148 402 2.0E-35
sp|Q6NYC1|JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens GN=JMJD6 PE=1 SV=1 148 402 2.0E-35
sp|Q6Q4H1|JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris GN=PSR PE=1 SV=1 153 401 4.0E-35
sp|Q7ZX37|JMD6B_XENLA Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-B OS=Xenopus laevis GN=jmjd6-b PE=2 SV=1 155 402 1.0E-34
sp|Q9ERI5|JMJD6_MOUSE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Mus musculus GN=Jmjd6 PE=1 SV=2 148 402 3.0E-34
sp|Q6AYK2|JMJD6_RAT Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Rattus norvegicus GN=Jmjd6 PE=2 SV=2 163 402 1.0E-33
sp|Q5ZMK5|JMJD6_CHICK Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Gallus gallus GN=JMJD6 PE=2 SV=1 163 402 1.0E-33
sp|Q623U2|JMJD6_CAEBR Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis briggsae GN=psr-1 PE=3 SV=1 190 401 3.0E-32
sp|Q08BY5|JMJD4_DANRE JmjC domain-containing protein 4 OS=Danio rerio GN=jmjd4 PE=2 SV=1 289 402 4.0E-09
sp|Q9VJ97|JMJD4_DROME JmjC domain-containing protein 4 homolog OS=Drosophila melanogaster GN=CG7200 PE=2 SV=1 245 401 7.0E-09
sp|Q5ZHV5|JMJD4_CHICK JmjC domain-containing protein 4 OS=Gallus gallus GN=JMJD4 PE=2 SV=1 289 402 2.0E-08
sp|Q9H9V9|JMJD4_HUMAN JmjC domain-containing protein 4 OS=Homo sapiens GN=JMJD4 PE=1 SV=2 289 402 1.0E-07
sp|Q3UWM4|KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus GN=Kdm7a PE=2 SV=2 268 402 3.0E-07
sp|Q6BXJ4|JHD1_DEBHA JmjC domain-containing histone demethylation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=JHD1 PE=3 SV=2 265 402 4.0E-07
sp|P0CF52|KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio GN=jhdm1db PE=2 SV=1 268 402 4.0E-07
sp|Q5RHD1|KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio GN=kdm7a PE=2 SV=2 268 402 5.0E-07
sp|Q6ZMT4|KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens GN=KDM7A PE=1 SV=2 268 402 1.0E-06
sp|Q8BFT6|JMJD4_MOUSE JmjC domain-containing protein 4 OS=Mus musculus GN=Jmjd4 PE=2 SV=1 289 402 2.0E-06
sp|Q96S16|JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens GN=JMJD8 PE=2 SV=1 167 398 2.0E-06
sp|Q08D35|KDM7A_XENTR Lysine-specific demethylase 7A OS=Xenopus tropicalis GN=kdm7a PE=2 SV=1 268 402 3.0E-06
sp|Q6AY40|JMJD8_RAT JmjC domain-containing protein 8 OS=Rattus norvegicus GN=Jmjd8 PE=2 SV=2 167 398 4.0E-06
sp|Q3TA59|JMJD8_MOUSE JmjC domain-containing protein 8 OS=Mus musculus GN=Jmjd8 PE=2 SV=2 167 398 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7660
MTNVAILCSRADASGGQAIPQIAHSAVDISDSIPLHPLGVKPSGNRYLSNDPDARASIGFWAMIPDELLMIILEQ
FQQLELLALGSTCRFLYAFCRADELWKSIFLGLTRKQSKAMPWRGTWRRTVRNISKDLQADIACTNVFSDVLHCP
FACTNVNLSQFVDNIPESHQIQRFATLSYEEYAQEWTEHPFILTDCIKEWPVCSQWTIPRLLEVYGHVEFRAEAV
DWTLEQYYSYMDDNMDESPLYLFDRMFAEKMGINIGNKPGAAYWRPDCFGPDLFAVLGNDRPAHRWLIIGPERSG
STFHKDPNGTSAWNAVIQGSKYWIMFPPTTQVPGVYVSRDRSEVTSPLSIAEWLLSFHGEARRLSECVEGVCRAG
EILHVPSGWWHLVVNLERGIALTQNFVPQSPSLSLLSEVLLFLRDKPNQVSGFSRSISDPYKLFTARLMQEQPML
LKRALETAERNQSKKRTWHDVAGSDNECRQDGDGGFSFGFCADDDDNEPTG*
Coding >OphauB2|7660
ATGACAAACGTAGCAATTCTTTGCTCGCGAGCCGATGCCTCTGGTGGACAGGCCATTCCTCAAATTGCTCACTCG
GCTGTAGATATTTCAGACTCAATTCCCTTACATCCTCTCGGAGTCAAACCGTCTGGAAATCGTTATCTTTCAAAT
GATCCTGACGCTAGAGCCAGCATTGGCTTCTGGGCGATGATACCTGATGAGCTGCTCATGATAATTCTGGAGCAG
TTTCAACAACTTGAGTTACTGGCTCTTGGCTCTACCTGCAGATTTCTCTACGCCTTTTGCCGCGCTGACGAACTG
TGGAAGTCGATATTCCTGGGGCTGACAAGAAAGCAAAGCAAAGCTATGCCCTGGAGAGGGACCTGGCGACGGACG
GTGCGGAATATTTCTAAAGATTTACAAGCCGATATTGCTTGTACCAACGTCTTTTCTGATGTTTTGCACTGCCCC
TTTGCATGCACAAACGTCAATTTATCTCAATTTGTCGACAACATTCCTGAGTCACATCAAATACAACGTTTTGCA
ACCCTCTCGTATGAAGAATACGCACAAGAATGGACGGAGCACCCCTTTATTCTGACGGATTGTATCAAAGAGTGG
CCTGTTTGCTCGCAGTGGACCATTCCCAGACTACTCGAAGTCTATGGCCATGTTGAATTTCGGGCGGAAGCGGTC
GATTGGACCTTGGAGCAGTACTACAGCTACATGGACGACAACATGGACGAGAGCCCACTGTATCTCTTTGATCGC
ATGTTTGCAGAGAAGATGGGTATTAACATCGGAAATAAGCCCGGCGCTGCGTACTGGCGGCCAGACTGCTTCGGA
CCCGATCTCTTTGCGGTACTGGGAAATGACCGGCCAGCTCACCGATGGCTCATAATTGGCCCTGAAAGAAGTGGC
TCAACATTTCACAAGGACCCTAATGGCACGAGCGCTTGGAACGCCGTGATTCAAGGCTCCAAGTACTGGATCATG
TTTCCTCCAACGACGCAAGTGCCCGGAGTTTACGTGTCTCGCGACAGGAGCGAAGTGACGAGTCCTTTAAGCATC
GCCGAGTGGCTGCTGAGTTTTCACGGAGAGGCACGCCGCCTGTCAGAATGCGTTGAGGGCGTCTGTAGGGCTGGA
GAGATTCTGCATGTGCCGAGCGGCTGGTGGCACCTTGTTGTTAATCTAGAGCGCGGCATTGCCCTGACGCAGAAC
TTTGTGCCACAGTCGCCCAGCTTGAGCCTACTGTCCGAAGTTTTGCTCTTCCTCAGAGATAAGCCGAACCAAGTG
TCTGGCTTCTCGAGAAGTATAAGCGATCCGTACAAGCTCTTCACGGCAAGGCTCATGCAAGAGCAGCCGATGCTT
TTGAAGAGAGCGTTGGAGACTGCTGAGAGAAACCAGAGCAAGAAGCGCACGTGGCATGACGTGGCTGGAAGCGAC
AACGAGTGTAGGCAAGATGGAGACGGCGGCTTCAGCTTTGGATTTTGTGCAGACGACGATGACAATGAGCCGACA
GGATAA
Transcript >OphauB2|7660
ATGACAAACGTAGCAATTCTTTGCTCGCGAGCCGATGCCTCTGGTGGACAGGCCATTCCTCAAATTGCTCACTCG
GCTGTAGATATTTCAGACTCAATTCCCTTACATCCTCTCGGAGTCAAACCGTCTGGAAATCGTTATCTTTCAAAT
GATCCTGACGCTAGAGCCAGCATTGGCTTCTGGGCGATGATACCTGATGAGCTGCTCATGATAATTCTGGAGCAG
TTTCAACAACTTGAGTTACTGGCTCTTGGCTCTACCTGCAGATTTCTCTACGCCTTTTGCCGCGCTGACGAACTG
TGGAAGTCGATATTCCTGGGGCTGACAAGAAAGCAAAGCAAAGCTATGCCCTGGAGAGGGACCTGGCGACGGACG
GTGCGGAATATTTCTAAAGATTTACAAGCCGATATTGCTTGTACCAACGTCTTTTCTGATGTTTTGCACTGCCCC
TTTGCATGCACAAACGTCAATTTATCTCAATTTGTCGACAACATTCCTGAGTCACATCAAATACAACGTTTTGCA
ACCCTCTCGTATGAAGAATACGCACAAGAATGGACGGAGCACCCCTTTATTCTGACGGATTGTATCAAAGAGTGG
CCTGTTTGCTCGCAGTGGACCATTCCCAGACTACTCGAAGTCTATGGCCATGTTGAATTTCGGGCGGAAGCGGTC
GATTGGACCTTGGAGCAGTACTACAGCTACATGGACGACAACATGGACGAGAGCCCACTGTATCTCTTTGATCGC
ATGTTTGCAGAGAAGATGGGTATTAACATCGGAAATAAGCCCGGCGCTGCGTACTGGCGGCCAGACTGCTTCGGA
CCCGATCTCTTTGCGGTACTGGGAAATGACCGGCCAGCTCACCGATGGCTCATAATTGGCCCTGAAAGAAGTGGC
TCAACATTTCACAAGGACCCTAATGGCACGAGCGCTTGGAACGCCGTGATTCAAGGCTCCAAGTACTGGATCATG
TTTCCTCCAACGACGCAAGTGCCCGGAGTTTACGTGTCTCGCGACAGGAGCGAAGTGACGAGTCCTTTAAGCATC
GCCGAGTGGCTGCTGAGTTTTCACGGAGAGGCACGCCGCCTGTCAGAATGCGTTGAGGGCGTCTGTAGGGCTGGA
GAGATTCTGCATGTGCCGAGCGGCTGGTGGCACCTTGTTGTTAATCTAGAGCGCGGCATTGCCCTGACGCAGAAC
TTTGTGCCACAGTCGCCCAGCTTGAGCCTACTGTCCGAAGTTTTGCTCTTCCTCAGAGATAAGCCGAACCAAGTG
TCTGGCTTCTCGAGAAGTATAAGCGATCCGTACAAGCTCTTCACGGCAAGGCTCATGCAAGAGCAGCCGATGCTT
TTGAAGAGAGCGTTGGAGACTGCTGAGAGAAACCAGAGCAAGAAGCGCACGTGGCATGACGTGGCTGGAAGCGAC
AACGAGTGTAGGCAAGATGGAGACGGCGGCTTCAGCTTTGGATTTTGTGCAGACGACGATGACAATGAGCCGACA
GGATAA
Gene >OphauB2|7660
ATGACAAACGTAGCAATTCTTTGCTCGCGAGCCGATGCCTCTGGTGGACAGGCCATTCCTCAAATTGCTCACTCG
GCTGTAGATATTTCAGACTCAATTCCCTTACATCCTCTCGGAGTCAAACCGTCTGGAAATCGTTATCTTTCAAAT
GATCCTGACGCTAGAGCCAGCATTGGCTTCTGGGCGATGATACCTGATGAGCTGCTCATGATAATTCTGGAGCAG
TTTCAACAACTTGAGTTACTGGCTCTTGGCTCTACCTGCAGATTTCTCTACGCCTTTTGCCGCGCTGACGAACTG
TGGAAGTCGATATTCCTGGGGTGAGTCGTGTTTGACTCACTCTGTTGTTGTCAGTGCTGTACACGCTGCATACAA
AAACCACCGCAGCAAAACTTGTCAAAGTTAATCCCTTGTCATGTTATTGACACCTTTTCATGCTCTTAGGGCCTT
GAGTGTGACTGATACATCTCTGGTCATGAGTATTTGCGATTAATTTCTTCTCATTATATTGATTTGTTGAAATTT
GTAGCTCACTCCAACAGTGAGCTAACTTTTGTACAGGCTGACAAGAAAGCAAAGCAAAGCTATGCCCTGGAGAGG
GACCTGGCGACGGACGGTGCGGAATATTTCTAAAGATTTACAAGCCGATATTGCTTGTACCAACGTCTTTTCTGA
TGTTTTGCACTGCCCCTTTGCATGCACAAACGTCAATTTATCTCAATTTGTCGACAACATTCCTGAGTCACATCA
AATACAACGTTTTGCAACCCTCTCGTATGAAGAATACGCACAAGAATGGACGGAGCACCCCTTTATTCTGACGGA
TTGTATCAAAGAGTGGCCTGTTTGCTCGCAGTGGACCATTCCCAGACTACTCGAAGTCTATGGCCATGTTGAATT
TCGGGCGGAAGCGGTCGATTGGACCTTGGAGCAGTACTACAGCTACATGGACGACAACATGGACGAGAGCCCACT
GTATCTCTTTGATCGCATGTTTGCAGAGAAGATGGGTATTAACATCGGAAATAAGCCCGGCGCTGCGTACTGGCG
GCCAGACTGCTTCGGACCCGATCTCTTTGCGGTACTGGGAAATGACCGGCCAGCTCACCGATGGCTCATAATTGG
CCCTGAAAGAAGTGGCTCAACATTTCACAAGGACCCTAATGGCACGAGCGCTTGGAACGCCGTGATTCAAGGCTC
CAAGTACTGGATCATGTTTCCTCCAACGACGCAAGTGCCCGGAGTTTACGTGTCTCGCGACAGGAGCGAAGTGAC
GAGTCCTTTAAGCATCGCCGAGTGGCTGCTGAGTTTTCACGGAGAGGCACGCCGCCTGTCAGAATGCGTTGAGGG
CGTCTGTAGGGCTGGAGAGATTCTGCATGTGCCGAGCGGCTGGTGGCACCTTGTTGTTAATCTAGAGCGCGGCAT
TGCCCTGACGCAGAACTTTGTGCCACAGTCGCCCAGCTTGAGCCTACTGTCCGAAGTTTTGCTCTTCCTCAGAGA
TAAGCCGAACCAAGTGTCTGGCTTCTCGAGAAGTATAAGCGATCCGTACAAGCTCTTCACGGCAAGGCTCATGCA
AGAGCAGCCGATGCTTTTGAAGAGAGCGTTGGAGACTGCTGAGAGAAACCAGAGCAAGAAGCGCACGTGGCATGA
CGTGGCTGGAAGCGACAACGAGTGTAGGCAAGATGGAGACGGCGGCTTCAGCTTTGGATTTTGTGCAGACGACGA
TGACAATGAGCCGACAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail