Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7659
Gene name
LocationContig_84:67047..68536
Strand-
Gene length (bp)1489
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 5.4E-45 49 213
PF00271 Helicase_C Helicase conserved C-terminal domain 9.6E-31 250 358
PF04851 ResIII Type III restriction enzyme, res subunit 2.2E-06 52 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QVP2|IF4A_MAGO7 ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF1 PE=3 SV=1 4 397 0.0E+00
sp|Q7RV88|IF4A_NEUCR ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-1 PE=3 SV=2 1 397 0.0E+00
sp|Q2HFP1|IF4A_CHAGB ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF1 PE=3 SV=1 1 397 0.0E+00
sp|A6RJ45|IF4A_BOTFB ATP-dependent RNA helicase eIF4A OS=Botryotinia fuckeliana (strain B05.10) GN=tif1 PE=3 SV=1 2 397 0.0E+00
sp|A7EGL7|IF4A_SCLS1 ATP-dependent RNA helicase eIF4A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif1 PE=3 SV=1 2 397 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QVP2|IF4A_MAGO7 ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF1 PE=3 SV=1 4 397 0.0E+00
sp|Q7RV88|IF4A_NEUCR ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-1 PE=3 SV=2 1 397 0.0E+00
sp|Q2HFP1|IF4A_CHAGB ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF1 PE=3 SV=1 1 397 0.0E+00
sp|A6RJ45|IF4A_BOTFB ATP-dependent RNA helicase eIF4A OS=Botryotinia fuckeliana (strain B05.10) GN=tif1 PE=3 SV=1 2 397 0.0E+00
sp|A7EGL7|IF4A_SCLS1 ATP-dependent RNA helicase eIF4A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif1 PE=3 SV=1 2 397 0.0E+00
sp|Q0UU86|IF4A_PHANO ATP-dependent RNA helicase eIF4A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF1 PE=3 SV=1 4 397 0.0E+00
sp|A1D7N3|IF4A_NEOFI ATP-dependent RNA helicase eIF4A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tif1 PE=3 SV=1 2 397 0.0E+00
sp|A1CJT5|IF4A_ASPCL ATP-dependent RNA helicase eIF4A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif1 PE=3 SV=1 2 397 0.0E+00
sp|Q5B948|IF4A_EMENI ATP-dependent RNA helicase eIF4A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif1 PE=3 SV=2 2 397 0.0E+00
sp|Q4WX43|IF4A_ASPFU ATP-dependent RNA helicase eIF4A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif1 PE=3 SV=1 2 394 0.0E+00
sp|Q1DQ20|IF4A_COCIM ATP-dependent RNA helicase eIF4A OS=Coccidioides immitis (strain RS) GN=TIF1 PE=3 SV=1 2 397 0.0E+00
sp|A2QEN5|IF4A_ASPNC ATP-dependent RNA helicase eIF4A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif1 PE=3 SV=1 2 397 0.0E+00
sp|Q0CXD0|IF4A_ASPTN ATP-dependent RNA helicase eIF4A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif1 PE=3 SV=2 4 397 0.0E+00
sp|Q2UPY3|IF4A_ASPOR ATP-dependent RNA helicase eIF4A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif1 PE=3 SV=1 1 397 0.0E+00
sp|A6R3R5|IF4A_AJECN ATP-dependent RNA helicase eIF4A OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TIF1 PE=3 SV=1 2 371 0.0E+00
sp|P47943|IF4A_SCHPO ATP-dependent RNA helicase eIF4A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif1 PE=1 SV=2 15 397 0.0E+00
sp|Q4P331|IF4A_USTMA ATP-dependent RNA helicase eIF4A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF1 PE=3 SV=1 9 397 0.0E+00
sp|Q5RKI1|IF4A2_RAT Eukaryotic initiation factor 4A-II OS=Rattus norvegicus GN=Eif4a2 PE=1 SV=1 11 397 0.0E+00
sp|Q5R4X1|IF4A2_PONAB Eukaryotic initiation factor 4A-II OS=Pongo abelii GN=EIF4A2 PE=2 SV=1 11 397 0.0E+00
sp|P10630|IF4A2_MOUSE Eukaryotic initiation factor 4A-II OS=Mus musculus GN=Eif4a2 PE=1 SV=2 11 397 0.0E+00
sp|Q14240|IF4A2_HUMAN Eukaryotic initiation factor 4A-II OS=Homo sapiens GN=EIF4A2 PE=1 SV=2 11 397 0.0E+00
sp|Q3SZ65|IF4A2_BOVIN Eukaryotic initiation factor 4A-II OS=Bos taurus GN=EIF4A2 PE=2 SV=1 11 397 0.0E+00
sp|P60843|IF4A1_MOUSE Eukaryotic initiation factor 4A-I OS=Mus musculus GN=Eif4a1 PE=1 SV=1 6 397 0.0E+00
sp|P60842|IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens GN=EIF4A1 PE=1 SV=1 6 397 0.0E+00
sp|Q3SZ54|IF4A1_BOVIN Eukaryotic initiation factor 4A-I OS=Bos taurus GN=EIF4A1 PE=2 SV=1 6 397 0.0E+00
sp|P29562|IF4A1_RABIT Eukaryotic initiation factor 4A-I (Fragment) OS=Oryctolagus cuniculus GN=EIF4A1 PE=1 SV=2 6 397 0.0E+00
sp|Q4R8K5|IF4A1_MACFA Eukaryotic initiation factor 4A-I OS=Macaca fascicularis GN=EIF4A1 PE=2 SV=1 6 397 0.0E+00
sp|Q8JFP1|IF4A2_CHICK Eukaryotic initiation factor 4A-II OS=Gallus gallus GN=EIF4A2 PE=2 SV=1 5 397 0.0E+00
sp|A5A6N4|IF4A1_PANTR Eukaryotic initiation factor 4A-I OS=Pan troglodytes GN=EIF4A1 PE=2 SV=1 6 397 0.0E+00
sp|Q4R4Y9|IF4A2_MACFA Eukaryotic initiation factor 4A-II OS=Macaca fascicularis GN=EIF4A2 PE=2 SV=1 11 397 0.0E+00
sp|Q5R5F5|IF4A1_PONAB Eukaryotic initiation factor 4A-I OS=Pongo abelii GN=EIF4A1 PE=2 SV=1 6 397 0.0E+00
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 12 397 0.0E+00
sp|P0CQ70|IF4A_CRYNJ ATP-dependent RNA helicase eIF4A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF1 PE=3 SV=1 2 397 0.0E+00
sp|P0CQ71|IF4A_CRYNB ATP-dependent RNA helicase eIF4A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF1 PE=3 SV=1 2 397 0.0E+00
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 8 397 0.0E+00
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 25 396 0.0E+00
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 25 396 0.0E+00
sp|Q6CDV4|IF4A_YARLI ATP-dependent RNA helicase eIF4A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF1 PE=3 SV=1 6 397 0.0E+00
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 25 397 0.0E+00
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 1 397 0.0E+00
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 14 397 0.0E+00
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 14 397 0.0E+00
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 14 397 0.0E+00
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 14 397 0.0E+00
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 25 397 0.0E+00
sp|P41376|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1 4 397 0.0E+00
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 17 397 0.0E+00
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 14 397 0.0E+00
sp|P35683|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2 17 397 0.0E+00
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 14 397 0.0E+00
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 25 397 0.0E+00
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 14 397 0.0E+00
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 25 397 0.0E+00
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 14 397 0.0E+00
sp|Q9CAI7|IF4A3_ARATH Eukaryotic initiation factor 4A-3 OS=Arabidopsis thaliana GN=TIF4A-3 PE=1 SV=1 17 397 0.0E+00
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 25 397 0.0E+00
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 14 397 0.0E+00
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 25 397 0.0E+00
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 14 397 0.0E+00
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 25 397 0.0E+00
sp|P41382|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1 17 397 0.0E+00
sp|P41377|IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana GN=TIF4A-2 PE=1 SV=1 4 397 0.0E+00
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 1 397 0.0E+00
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 14 397 0.0E+00
sp|P41379|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1 17 397 0.0E+00
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 25 397 0.0E+00
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 15 397 0.0E+00
sp|Q40467|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1 17 397 0.0E+00
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 1 397 0.0E+00
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 25 397 0.0E+00
sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 17 397 0.0E+00
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 23 397 0.0E+00
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 13 397 0.0E+00
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 25 397 0.0E+00
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 14 397 0.0E+00
sp|Q40470|IF4A7_TOBAC Eukaryotic initiation factor 4A-7 OS=Nicotiana tabacum PE=2 SV=1 17 397 0.0E+00
sp|Q40465|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1 17 397 0.0E+00
sp|Q40471|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1 12 397 0.0E+00
sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A OS=Triticum aestivum PE=2 SV=1 8 397 0.0E+00
sp|Q02748|IF4A_DROME Eukaryotic initiation factor 4A OS=Drosophila melanogaster GN=eIF-4a PE=1 SV=3 11 397 0.0E+00
sp|P41381|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1 17 397 0.0E+00
sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A OS=Zea mays PE=2 SV=1 4 397 0.0E+00
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 21 397 0.0E+00
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 21 397 0.0E+00
sp|A5DB98|IF4A_PICGU ATP-dependent RNA helicase eIF4A OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF1 PE=3 SV=1 7 396 0.0E+00
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 25 392 0.0E+00
sp|Q40468|IF415_TOBAC Eukaryotic initiation factor 4A-15 OS=Nicotiana tabacum PE=2 SV=1 17 397 0.0E+00
sp|Q6BRN4|IF4A_DEBHA ATP-dependent RNA helicase eIF4A OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF1 PE=3 SV=1 5 396 0.0E+00
sp|P41380|IF4A3_NICPL Eukaryotic initiation factor 4A-3 OS=Nicotiana plumbaginifolia PE=2 SV=1 21 397 0.0E+00
sp|A3GFI4|IF4A_PICST ATP-dependent RNA helicase eIF4A OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF1 PE=3 SV=1 1 396 0.0E+00
sp|A7TK55|IF4A_VANPO ATP-dependent RNA helicase eIF4A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TIF1 PE=3 SV=1 5 396 0.0E+00
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 4 397 0.0E+00
sp|A5DVM3|IF4A_LODEL ATP-dependent RNA helicase eIF4A OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF1 PE=3 SV=1 1 396 0.0E+00
sp|P87206|IF4A_CANAL ATP-dependent RNA helicase eIF4A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF1 PE=3 SV=1 5 396 0.0E+00
sp|P10081|IF4A_YEAST ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF1 PE=1 SV=3 5 397 0.0E+00
sp|A6ZQJ1|IF4A_YEAS7 ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF1 PE=3 SV=1 5 397 0.0E+00
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 21 397 0.0E+00
sp|Q6CXT4|IF4A_KLULA ATP-dependent RNA helicase eIF4A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIF1 PE=3 SV=1 6 396 0.0E+00
sp|Q6FQQ6|IF4A_CANGA ATP-dependent RNA helicase eIF4A OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIF1 PE=3 SV=1 1 396 0.0E+00
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 1 382 0.0E+00
sp|Q75BL8|IF4A_ASHGO ATP-dependent RNA helicase eIF4A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIF1 PE=3 SV=1 11 396 0.0E+00
sp|Q0UAT0|FAL1_PHANO ATP-dependent RNA helicase FAL1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FAL1 PE=3 SV=3 25 397 0.0E+00
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 25 397 0.0E+00
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 21 397 0.0E+00
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 25 397 0.0E+00
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 25 397 0.0E+00
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 25 397 7.0E-178
sp|A5DE68|FAL1_PICGU ATP-dependent RNA helicase FAL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FAL1 PE=3 SV=2 25 397 2.0E-177
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 25 396 1.0E-172
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 25 396 1.0E-172
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 25 396 2.0E-171
sp|Q40466|IF413_TOBAC Eukaryotic initiation factor 4A-13 (Fragment) OS=Nicotiana tabacum PE=2 SV=1 17 339 6.0E-171
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 25 396 9.0E-171
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 25 396 2.0E-170
sp|Q9C8J1|RH34_ARATH DEAD-box ATP-dependent RNA helicase 34 OS=Arabidopsis thaliana GN=RH34 PE=2 SV=2 23 397 6.0E-170
sp|Q755W0|FAL1_ASHGO ATP-dependent RNA helicase FAL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FAL1 PE=3 SV=2 25 396 2.0E-166
sp|O62591|IF4A_LEIMA Probable eukaryotic initiation factor 4A OS=Leishmania major GN=LmjF.01.0770 PE=3 SV=1 23 394 3.0E-158
sp|A4HRK0|IF4A_LEIIN Probable eukaryotic initiation factor 4A OS=Leishmania infantum GN=LinJ01.0780 PE=3 SV=1 23 394 3.0E-158
sp|Q25225|IF4A_LEIBR Probable eukaryotic initiation factor 4A OS=Leishmania braziliensis GN=LbrM01_V2.0740 PE=3 SV=2 23 394 5.0E-158
sp|Q38F76|IF4A_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb09.160.3270 PE=3 SV=1 23 394 7.0E-156
sp|Q4E162|IF4A_TRYCC Probable eukaryotic initiation factor 4A OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511585.190 PE=3 SV=1 23 394 5.0E-151
sp|Q40469|IF4A6_TOBAC Eukaryotic initiation factor 4A-6 (Fragment) OS=Nicotiana tabacum PE=2 SV=1 144 396 5.0E-137
sp|Q0E2Q3|IF4A2_ORYSJ Putative eukaryotic initiation factor 4A-2 OS=Oryza sativa subsp. japonica GN=Os02g0221300 PE=3 SV=2 44 397 7.0E-108
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 9 393 7.0E-104
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 14 393 1.0E-102
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 14 393 2.0E-102
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 24 393 5.0E-102
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 14 393 8.0E-102
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 24 393 2.0E-101
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 24 393 1.0E-100
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 24 393 1.0E-100
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 25 393 1.0E-100
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 24 393 1.0E-100
sp|Q6C0X2|DHH1_YARLI ATP-dependent RNA helicase DHH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DHH1 PE=3 SV=1 25 393 4.0E-98
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 24 390 8.0E-98
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 24 393 2.0E-97
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 24 393 2.0E-97
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 26 390 9.0E-97
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 26 393 2.0E-96
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 26 393 3.0E-96
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 25 389 5.0E-96
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 26 393 5.0E-96
sp|Q4P7Z8|DBP5_USTMA ATP-dependent RNA helicase DBP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP5 PE=3 SV=1 22 392 1.0E-95
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 26 393 1.0E-95
sp|Q4WWD3|DHH1_ASPFU ATP-dependent RNA helicase dhh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dhh1 PE=3 SV=1 26 393 1.0E-95
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 26 393 2.0E-95
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 26 393 3.0E-95
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 24 390 3.0E-95
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 26 393 4.0E-95
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 24 393 4.0E-95
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 26 393 4.0E-95
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 26 393 6.0E-95
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 25 389 1.0E-94
sp|Q58Z64|DHH1_CRYNH ATP-dependent RNA helicase VAD1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=VAD1 PE=2 SV=1 26 390 1.0E-94
sp|P0CQ80|DHH1_CRYNJ ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DHH1 PE=3 SV=1 26 390 2.0E-94
sp|P0CQ81|DHH1_CRYNB ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DHH1 PE=3 SV=1 26 390 2.0E-94
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 26 393 2.0E-94
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 24 393 3.0E-94
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 24 393 4.0E-94
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 26 393 4.0E-94
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 26 393 5.0E-94
sp|A5DZX2|DBP5_LODEL ATP-dependent RNA helicase DBP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP5 PE=3 SV=1 22 385 2.0E-93
sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=1 SV=1 24 393 2.0E-93
sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 24 393 2.0E-93
sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 24 393 2.0E-93
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 25 389 3.0E-93
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 25 389 4.0E-93
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 25 389 4.0E-93
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 25 389 5.0E-93
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 25 389 5.0E-93
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 25 389 5.0E-93
sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 24 393 7.0E-93
sp|Q5ZKB9|DDX6_CHICK Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1 24 393 1.0E-92
sp|Q5AJD0|DBP5_CANAL ATP-dependent RNA helicase DBP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP5 PE=3 SV=1 22 367 1.0E-92
sp|Q8SQM5|IF4A_ENCCU ATP-dependent RNA helicase eIF4A OS=Encephalitozoon cuniculi (strain GB-M1) GN=TIF1 PE=1 SV=1 24 394 1.0E-92
sp|Q9WTM2|DDX6_CAVPO Probable ATP-dependent RNA helicase DDX6 (Fragment) OS=Cavia porcellus GN=DDX6 PE=2 SV=1 24 393 2.0E-92
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 25 389 2.0E-92
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 26 390 3.0E-92
sp|Q09747|DBP5_SCHPO ATP-dependent RNA helicase dbp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp5 PE=1 SV=1 22 390 3.0E-92
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 26 395 5.0E-92
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 26 395 5.0E-92
sp|A5DBI5|DBP5_PICGU ATP-dependent RNA helicase DBP5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP5 PE=3 SV=1 22 383 7.0E-92
sp|A2QUY7|DBP5_ASPNC ATP-dependent RNA helicase dbp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp5 PE=3 SV=1 22 389 3.0E-91
sp|Q5RFQ5|DDX6_PONAB Probable ATP-dependent RNA helicase DDX6 OS=Pongo abelii GN=DDX6 PE=2 SV=1 24 393 3.0E-91
sp|A3GH91|DBP5_PICST ATP-dependent RNA helicase DBP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP5 PE=3 SV=2 22 367 9.0E-91
sp|Q0CDT1|DBP5_ASPTN ATP-dependent RNA helicase dbp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp5 PE=3 SV=1 22 389 1.0E-90
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 26 380 1.0E-90
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 26 391 4.0E-90
sp|A1CFV3|DBP5_ASPCL ATP-dependent RNA helicase dbp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp5 PE=3 SV=1 22 389 5.0E-90
sp|Q9DGP9|DDX25_XENLA ATP-dependent RNA helicase DDX25 OS=Xenopus laevis GN=deadsouth PE=2 SV=1 22 389 5.0E-90
sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 24 390 7.0E-90
sp|Q2U8K6|DBP5_ASPOR ATP-dependent RNA helicase dbp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp5 PE=3 SV=1 22 389 2.0E-89
sp|Q6BRE4|DBP5_DEBHA ATP-dependent RNA helicase DBP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP5 PE=3 SV=1 22 367 3.0E-89
sp|Q8X0X2|DBP5_NEUCR ATP-dependent RNA helicase dbp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-5 PE=3 SV=1 22 396 4.0E-89
sp|P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP5 PE=1 SV=2 22 382 1.0E-88
sp|A6ZNQ1|DBP5_YEAS7 ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP5 PE=3 SV=1 22 382 1.0E-88
sp|Q5AVM1|DBP5_EMENI ATP-dependent RNA helicase dbp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp5 PE=3 SV=1 2 389 2.0E-88
sp|Q9UMR2|DD19B_HUMAN ATP-dependent RNA helicase DDX19B OS=Homo sapiens GN=DDX19B PE=1 SV=1 22 389 2.0E-88
sp|Q61655|DD19A_MOUSE ATP-dependent RNA helicase DDX19A OS=Mus musculus GN=Ddx19a PE=1 SV=2 22 389 2.0E-88
sp|P0CQ87|DBP5_CRYNB ATP-dependent RNA helicase DBP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP5 PE=3 SV=1 22 384 2.0E-88
sp|Q9NUU7|DD19A_HUMAN ATP-dependent RNA helicase DDX19A OS=Homo sapiens GN=DDX19A PE=1 SV=1 22 389 3.0E-88
sp|P0CQ86|DBP5_CRYNJ ATP-dependent RNA helicase DBP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP5 PE=3 SV=1 22 384 3.0E-88
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 26 389 1.0E-87
sp|Q4WIN6|DBP5_ASPFU ATP-dependent RNA helicase dbp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp5 PE=3 SV=2 22 389 2.0E-87
sp|Q6C3X7|DBP5_YARLI ATP-dependent RNA helicase DBP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP5 PE=3 SV=1 26 367 3.0E-87
sp|A1CYG5|DBP5_NEOFI ATP-dependent RNA helicase dbp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp5 PE=3 SV=1 22 389 3.0E-87
sp|Q75C39|DBP5_ASHGO ATP-dependent RNA helicase DBP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP5 PE=3 SV=2 22 367 8.0E-87
sp|Q3ZBV2|DD19A_BOVIN ATP-dependent RNA helicase DDX19A OS=Bos taurus GN=DDX19A PE=2 SV=1 22 389 8.0E-87
sp|Q1EB85|DBP5_COCIM ATP-dependent RNA helicase DBP5 OS=Coccidioides immitis (strain RS) GN=DBP5 PE=3 SV=1 22 387 9.0E-87
sp|A6RC50|DBP5_AJECN ATP-dependent RNA helicase DBP5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP5 PE=3 SV=1 22 389 1.0E-86
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 25 379 6.0E-86
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 25 379 6.0E-86
sp|Q9QY15|DDX25_MOUSE ATP-dependent RNA helicase DDX25 OS=Mus musculus GN=Ddx25 PE=1 SV=2 22 389 9.0E-86
sp|Q6CJU1|DBP5_KLULA ATP-dependent RNA helicase DBP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP5 PE=3 SV=1 22 367 3.0E-85
sp|Q9QY16|DDX25_RAT ATP-dependent RNA helicase DDX25 OS=Rattus norvegicus GN=Ddx25 PE=1 SV=2 22 389 4.0E-85
sp|A7EY76|DBP5_SCLS1 ATP-dependent RNA helicase dbp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp5 PE=3 SV=1 7 367 8.0E-85
sp|A5E3W5|SUB2_LODEL ATP-dependent RNA helicase SUB2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SUB2 PE=3 SV=1 26 390 1.0E-84
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 16 380 2.0E-84
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 16 380 2.0E-84
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 25 386 3.0E-84
sp|Q0UCB9|DBP5_PHANO ATP-dependent RNA helicase DBP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP5 PE=3 SV=1 22 395 3.0E-84
sp|Q4HY71|DBP5_GIBZE ATP-dependent RNA helicase DBP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP5 PE=3 SV=1 6 367 4.0E-84
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 26 388 5.0E-84
sp|O61305|DDX19_DROME DEAD-box helicase Dbp80 OS=Drosophila melanogaster GN=Dbp80 PE=1 SV=1 21 395 5.0E-84
sp|Q2HGF7|DBP5_CHAGB ATP-dependent RNA helicase DBP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP5 PE=3 SV=1 23 367 4.0E-83
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 26 395 4.0E-83
sp|Q6FKN8|DBP5_CANGA ATP-dependent RNA helicase DBP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP5 PE=3 SV=1 22 367 6.0E-83
sp|Q2TBP1|DDX25_BOVIN ATP-dependent RNA helicase DDX25 OS=Bos taurus GN=DDX25 PE=2 SV=1 22 389 7.0E-83
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 25 397 2.0E-82
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 25 397 2.0E-82
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 25 397 2.0E-82
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 25 397 2.0E-82
sp|A4RBS3|SUB2_MAGO7 ATP-dependent RNA helicase SUB2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SUB2 PE=3 SV=1 25 395 2.0E-82
sp|A6SBT4|DBP5_BOTFB ATP-dependent RNA helicase dbp5 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp5 PE=3 SV=1 22 367 3.0E-82
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 25 379 6.0E-82
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 25 379 6.0E-82
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 25 379 6.0E-82
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 25 379 6.0E-82
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 25 379 6.0E-82
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 25 379 6.0E-82
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 25 379 6.0E-82
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 25 379 6.0E-82
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 25 379 8.0E-82
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 26 395 9.0E-82
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 25 390 1.0E-81
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 25 379 1.0E-81
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 26 395 1.0E-81
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 25 387 2.0E-81
sp|Q9UHL0|DDX25_HUMAN ATP-dependent RNA helicase DDX25 OS=Homo sapiens GN=DDX25 PE=1 SV=2 22 389 3.0E-81
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 26 395 3.0E-81
sp|Q4WCW2|SUB2_ASPFU ATP-dependent RNA helicase sub2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sub2 PE=3 SV=1 26 395 4.0E-81
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 25 379 4.0E-81
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 25 386 1.0E-80
sp|Q6BME5|SUB2_DEBHA ATP-dependent RNA helicase SUB2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUB2 PE=3 SV=2 26 390 1.0E-80
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 26 395 2.0E-80
sp|A4RIF1|DBP5_MAGO7 ATP-dependent RNA helicase DBP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP5 PE=3 SV=2 13 367 2.0E-80
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 25 379 2.0E-80
sp|A3LST5|SUB2_PICST ATP-dependent RNA helicase SUB2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SUB2 PE=3 SV=1 26 395 3.0E-80
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 25 397 3.0E-80
sp|A5DDN0|SUB2_PICGU ATP-dependent RNA helicase SUB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SUB2 PE=3 SV=3 26 390 3.0E-80
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 26 390 4.0E-80
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 26 390 4.0E-80
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 26 390 4.0E-80
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 26 390 5.0E-80
sp|Q54TF8|DDX19_DICDI ATP-dependent RNA helicase ddx19 OS=Dictyostelium discoideum GN=helC PE=2 SV=1 22 367 7.0E-80
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 26 390 7.0E-80
sp|P0CQ96|SUB2_CRYNJ ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SUB2 PE=3 SV=1 26 393 1.0E-79
sp|P0CQ97|SUB2_CRYNB ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SUB2 PE=3 SV=1 26 393 1.0E-79
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 26 395 1.0E-79
sp|Q0CGJ9|SUB2_ASPTN ATP-dependent RNA helicase sub2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sub2 PE=3 SV=1 26 395 2.0E-79
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 25 391 1.0E-78
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2 11 390 1.0E-78
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 26 390 2.0E-78
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 21 391 3.0E-78
sp|Q0TXZ2|SUB2_PHANO ATP-dependent RNA helicase SUB2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SUB2 PE=3 SV=1 25 390 3.0E-78
sp|Q63413|DX39B_RAT Spliceosome RNA helicase Ddx39b OS=Rattus norvegicus GN=Ddx39b PE=2 SV=3 26 390 4.0E-78
sp|Q9Z1N5|DX39B_MOUSE Spliceosome RNA helicase Ddx39b OS=Mus musculus GN=Ddx39b PE=1 SV=1 26 390 4.0E-78
sp|Q5WR10|DX39B_CANLF Spliceosome RNA helicase DDX39B OS=Canis lupus familiaris GN=DDX39B PE=3 SV=1 26 390 5.0E-78
sp|Q5RE47|DX39B_PONAB Spliceosome RNA helicase DDX39B OS=Pongo abelii GN=DDX39B PE=2 SV=1 25 390 5.0E-78
sp|Q29024|DX39B_PIG Spliceosome RNA helicase DDX39B OS=Sus scrofa GN=DDX39B PE=3 SV=2 25 390 5.0E-78
sp|P60024|DX39B_PANTR Spliceosome RNA helicase DDX39B OS=Pan troglodytes GN=DDX39B PE=3 SV=1 25 390 5.0E-78
sp|Q5TM17|DX39B_MACMU Spliceosome RNA helicase DDX39B OS=Macaca mulatta GN=DDX39B PE=3 SV=1 25 390 5.0E-78
sp|Q13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B OS=Homo sapiens GN=DDX39B PE=1 SV=1 25 390 5.0E-78
sp|A7EIX7|SUB2_SCLS1 ATP-dependent RNA helicase sub2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sub2 PE=3 SV=1 25 390 6.0E-78
sp|Q5ZHZ0|DX39B_CHICK Spliceosome RNA helicase DDX39B OS=Gallus gallus GN=DDX39B PE=2 SV=1 2 390 7.0E-78
sp|Q10RI7|RH38_ORYSJ DEAD-box ATP-dependent RNA helicase 38 OS=Oryza sativa subsp. japonica GN=Os03g0158200 PE=3 SV=1 7 389 1.0E-77
sp|Q8VDW0|DX39A_MOUSE ATP-dependent RNA helicase DDX39A OS=Mus musculus GN=Ddx39a PE=1 SV=1 11 390 1.0E-77
sp|Q5ASK8|SUB2_EMENI ATP-dependent RNA helicase sub2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sub2 PE=3 SV=2 25 390 1.0E-77
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 25 397 1.0E-77
sp|Q5U216|DX39A_RAT ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus GN=Ddx39a PE=2 SV=1 11 390 1.0E-77
sp|Q759L6|SUB2_ASHGO ATP-dependent RNA helicase SUB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SUB2 PE=3 SV=1 25 390 2.0E-77
sp|Q9JJY4|DDX20_MOUSE Probable ATP-dependent RNA helicase DDX20 OS=Mus musculus GN=Ddx20 PE=1 SV=2 26 380 2.0E-77
sp|Q3T147|DX39B_BOVIN Spliceosome RNA helicase DDX39B OS=Bos taurus GN=DDX39B PE=2 SV=1 26 390 4.0E-77
sp|Q9UHI6|DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens GN=DDX20 PE=1 SV=2 26 390 7.0E-77
sp|A7TJT7|SUB22_VANPO ATP-dependent RNA helicase SUB2-2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-2 PE=3 SV=1 26 390 8.0E-77
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 25 397 8.0E-77
sp|A6ZXP4|SUB2_YEAS7 ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain YJM789) GN=SUB2 PE=3 SV=1 26 390 1.0E-76
sp|Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUB2 PE=1 SV=1 26 390 1.0E-76
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 25 389 2.0E-76
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 43 387 4.0E-76
sp|Q27268|DX39B_DROME ATP-dependent RNA helicase WM6 OS=Drosophila melanogaster GN=Hel25E PE=1 SV=1 8 390 7.0E-76
sp|Q6CM95|SUB2_KLULA ATP-dependent RNA helicase SUB2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUB2 PE=3 SV=1 26 390 7.0E-76
sp|A7TLA0|SUB21_VANPO ATP-dependent RNA helicase SUB2-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-1 PE=3 SV=1 26 390 9.0E-76
sp|Q18212|DX39B_CAEEL Spliceosome RNA helicase DDX39B homolog OS=Caenorhabditis elegans GN=hel-1 PE=2 SV=1 25 393 3.0E-75
sp|Q6FL17|SUB2_CANGA ATP-dependent RNA helicase SUB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SUB2 PE=3 SV=1 26 390 3.0E-75
sp|P0C218|DDX20_DANRE Probable ATP-dependent RNA helicase DDX20 OS=Danio rerio GN=ddx20 PE=3 SV=1 26 390 1.0E-73
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 25 386 2.0E-73
sp|Q93ZG7|RH38_ARATH DEAD-box ATP-dependent RNA helicase 38 OS=Arabidopsis thaliana GN=RH38 PE=1 SV=2 26 389 4.0E-73
sp|Q8SQK9|DHH1_ENCCU ATP-dependent RNA helicase DHH1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHH1 PE=3 SV=2 25 389 2.0E-71
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 17 386 2.0E-70
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 17 386 3.0E-70
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 25 373 7.0E-69
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 28 390 1.0E-68
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 25 392 4.0E-68
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 41 395 2.0E-67
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 25 389 4.0E-67
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 25 390 6.0E-67
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 25 396 8.0E-67
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 29 390 9.0E-67
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 25 394 2.0E-66
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 25 389 3.0E-66
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 25 390 4.0E-66
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 15 390 5.0E-66
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 1 390 5.0E-66
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 25 388 1.0E-65
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 21 378 2.0E-65
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 21 378 3.0E-65
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 20 386 3.0E-65
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 28 388 5.0E-65
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 7 390 7.0E-65
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 26 397 8.0E-65
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 8 390 2.0E-64
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 21 380 4.0E-64
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 18 396 5.0E-64
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 21 380 5.0E-64
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 17 389 6.0E-64
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 22 381 7.0E-64
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 50 397 7.0E-64
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 25 389 8.0E-64
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 21 380 8.0E-64
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 21 389 8.0E-64
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 25 389 9.0E-64
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 7 397 1.0E-63
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 25 387 1.0E-63
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 20 390 1.0E-63
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 12 388 2.0E-63
sp|Q818H2|CSHB_BACCR DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshB PE=2 SV=1 22 379 3.0E-63
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 16 380 3.0E-63
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 16 380 3.0E-63
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 26 394 4.0E-63
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 18 378 4.0E-63
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 18 397 5.0E-63
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 8 388 1.0E-62
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 21 380 1.0E-62
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 18 397 1.0E-62
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 21 380 1.0E-62
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 21 380 1.0E-62
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 26 390 2.0E-62
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 18 397 2.0E-62
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 18 397 2.0E-62
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 1 390 2.0E-62
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 25 388 3.0E-62
sp|Q8Y755|CSHB_LISMO DEAD-box ATP-dependent RNA helicase CshB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshB PE=2 SV=1 26 374 3.0E-62
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 26 379 4.0E-62
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 18 396 4.0E-62
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 18 396 4.0E-62
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 8 397 5.0E-62
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 25 388 5.0E-62
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 23 397 5.0E-62
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 25 390 6.0E-62
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 21 380 8.0E-62
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 26 390 9.0E-62
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 8 388 1.0E-61
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 18 396 1.0E-61
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 18 396 1.0E-61
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 26 391 1.0E-61
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 23 396 1.0E-61
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 16 390 1.0E-61
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 20 390 2.0E-61
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 23 392 2.0E-61
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 29 380 2.0E-61
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 25 388 2.0E-61
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 12 390 2.0E-61
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 8 397 2.0E-61
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 15 388 3.0E-61
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 25 388 3.0E-61
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 26 390 4.0E-61
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 17 378 6.0E-61
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 8 390 6.0E-61
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 23 396 6.0E-61
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 22 386 8.0E-61
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 22 386 8.0E-61
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 26 390 9.0E-61
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 26 390 9.0E-61
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 26 390 9.0E-61
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 20 378 9.0E-61
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 23 395 1.0E-60
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 22 385 1.0E-60
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 21 391 2.0E-60
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 23 395 2.0E-60
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 8 397 2.0E-60
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 8 397 2.0E-60
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 25 381 2.0E-60
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 20 391 2.0E-60
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 25 388 3.0E-60
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 16 388 3.0E-60
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 8 380 3.0E-60
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 23 377 3.0E-60
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 23 387 3.0E-60
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 18 378 4.0E-60
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 17 378 4.0E-60
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 21 396 5.0E-60
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 26 386 5.0E-60
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 26 386 5.0E-60
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 26 386 5.0E-60
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 26 386 5.0E-60
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 18 378 6.0E-60
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 26 386 6.0E-60
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 26 386 6.0E-60
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 8 390 6.0E-60
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 7 388 8.0E-60
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 8 392 9.0E-60
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 17 378 1.0E-59
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 18 378 1.0E-59
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 17 378 1.0E-59
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 8 396 1.0E-59
sp|Q54ZI9|DDX20_DICDI Probable ATP-dependent RNA helicase ddx20 OS=Dictyostelium discoideum GN=ddx20 PE=3 SV=2 25 368 1.0E-59
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 26 386 1.0E-59
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 8 390 2.0E-59
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 8 397 2.0E-59
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 6 395 2.0E-59
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 17 378 3.0E-59
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 23 387 4.0E-59
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 25 381 4.0E-59
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 23 393 6.0E-59
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 26 381 6.0E-59
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 18 396 7.0E-59
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 25 390 7.0E-59
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 17 378 9.0E-59
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 25 390 1.0E-58
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 25 388 1.0E-58
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 18 368 2.0E-58
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 10 376 2.0E-58
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 26 386 2.0E-58
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 22 386 3.0E-58
sp|Q9CJS1|RHLB_PASMU ATP-dependent RNA helicase RhlB OS=Pasteurella multocida (strain Pm70) GN=rhlB PE=3 SV=1 15 397 3.0E-58
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 17 378 5.0E-58
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 26 386 6.0E-58
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 22 386 6.0E-58
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 22 386 6.0E-58
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 8 397 7.0E-58
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 8 390 7.0E-58
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 8 390 8.0E-58
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 10 376 9.0E-58
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 25 388 1.0E-57
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 23 368 1.0E-57
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 7 371 1.0E-57
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 25 386 1.0E-57
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 25 386 1.0E-57
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 26 372 1.0E-57
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 22 381 1.0E-57
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 10 367 2.0E-57
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 22 381 2.0E-57
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 25 392 2.0E-57
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 23 396 2.0E-57
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 25 386 2.0E-57
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 4 387 2.0E-57
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 25 392 2.0E-57
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 8 390 3.0E-57
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 18 368 3.0E-57
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 12 378 3.0E-57
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 25 392 3.0E-57
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 25 392 3.0E-57
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 25 392 3.0E-57
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 25 386 3.0E-57
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 26 386 4.0E-57
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 23 368 4.0E-57
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 16 376 4.0E-57
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 25 387 4.0E-57
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 8 396 5.0E-57
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 22 397 5.0E-57
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 26 386 5.0E-57
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 8 390 5.0E-57
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 26 386 5.0E-57
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 22 397 5.0E-57
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 21 390 5.0E-57
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 16 367 5.0E-57
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 44 371 5.0E-57
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 15 388 5.0E-57
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 22 397 6.0E-57
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 22 397 6.0E-57
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 25 387 7.0E-57
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 26 386 7.0E-57
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 25 394 7.0E-57
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 22 386 7.0E-57
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 25 392 8.0E-57
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 22 381 8.0E-57
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 25 381 9.0E-57
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 26 381 1.0E-56
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 25 378 1.0E-56
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup89
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3172
Ophiocordyceps australis 1348a (Ghana) OphauG2|6087
Ophiocordyceps australis map64 (Brazil) OphauB2|1732
Ophiocordyceps australis map64 (Brazil) OphauB2|7659 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00403
Ophiocordyceps camponoti-floridani Ophcf2|05292
Ophiocordyceps camponoti-rufipedis Ophun1|372
Ophiocordyceps camponoti-rufipedis Ophun1|3975
Ophiocordyceps kimflemingae Ophio5|6345
Ophiocordyceps kimflemingae Ophio5|8281
Ophiocordyceps subramaniannii Hirsu2|5187
Ophiocordyceps subramaniannii Hirsu2|5188
Ophiocordyceps subramaniannii Hirsu2|52
Ophiocordyceps subramaniannii Hirsu2|5997

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7659
MATDKGLEDVPEGQIESNYDETVDSFDDMNLKSELLRGVYAYGFERPSAIQQRAIMPVIKSHDVIAQAQSGTGKT
ATFSISVLQKIDHSVKQCQALILAPTRELAQQIQKVVVAIGDFMNVECHACIGGTSVRDDMKALQDGPQVVVGTP
GRVHDMIQRRFLRTDAMKMFVLDEADEMLSRGFTDQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTRFMRDPVRI
LVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQA
QRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMM
REIEQFYSTQIEEMPMNVADLI*
Coding >OphauB2|7659
ATGGCTACCGACAAGGGACTCGAGGATGTCCCTGAGGGACAAATCGAGTCCAACTATGACGAGACGGTTGACTCA
TTCGATGACATGAATCTCAAATCTGAGCTCCTTCGTGGCGTGTACGCATATGGCTTCGAGCGCCCTTCTGCTATC
CAGCAGCGTGCCATTATGCCCGTCATCAAGAGCCACGATGTTATTGCCCAGGCCCAATCTGGAACTGGCAAGACT
GCCACATTCTCGATTTCGGTCCTGCAGAAGATCGATCATTCGGTCAAGCAGTGTCAGGCTTTGATTCTTGCCCCT
ACACGTGAGCTTGCTCAGCAAATCCAAAAAGTGGTCGTGGCCATTGGCGACTTCATGAATGTTGAATGCCATGCT
TGCATCGGTGGCACCAGCGTTCGCGACGACATGAAGGCCCTTCAGGATGGTCCCCAGGTTGTGGTGGGCACTCCT
GGTCGTGTCCACGACATGATTCAGCGTCGTTTTCTTCGTACCGATGCCATGAAGATGTTTGTTCTTGATGAGGCA
GATGAGATGCTCTCTCGAGGCTTCACGGACCAAATCTACGATATCTTCCAGCTGCTTCCACAGTCGACCCAAGTT
GTGTTGTTGTCTGCTACCATGCCTCAAGATGTCCTCGAGGTCACCACGCGCTTCATGCGTGACCCTGTTCGTATC
CTTGTTAAGAAGGACGAACTGACTCTTGAGGGTATCAAGCAATTTTACATTGCCGTCGAAAAAGAAGAGTGGAAA
CTTGACACCCTCTCTGATTTATACGAGACAGTCACCATCACCCAAGCAGTCATCTTTTGCAATACACGCAGAAAG
GTGGACTGGCTTACCGATAAGCTAACGGCTCGTGACTTCACCGTGTCAGCCATGCACGGAGATATGGACCAGGCG
CAACGCGACCTAATCATGAAGGAGTTCCGATCTGGTTCTTCTCGTGTCCTGATCGCGACTGATCTTCTGGCTCGT
GGAATCGACGTACAACAAGTTTCTCTCGTCATCAACTATGACTTGCCCGCCAATCGCGAAAATTATATCCATCGG
ATTGGTCGTGGCGGTCGATTTGGTCGCAAAGGTGTCGCGATCAACTTTGTCACGGCTGATGATGTTCGTATGATG
CGTGAGATTGAACAGTTTTACAGCACTCAGATTGAGGAGATGCCGATGAATGTTGCCGACCTCATTTAA
Transcript >OphauB2|7659
ATGGCTACCGACAAGGGACTCGAGGATGTCCCTGAGGGACAAATCGAGTCCAACTATGACGAGACGGTTGACTCA
TTCGATGACATGAATCTCAAATCTGAGCTCCTTCGTGGCGTGTACGCATATGGCTTCGAGCGCCCTTCTGCTATC
CAGCAGCGTGCCATTATGCCCGTCATCAAGAGCCACGATGTTATTGCCCAGGCCCAATCTGGAACTGGCAAGACT
GCCACATTCTCGATTTCGGTCCTGCAGAAGATCGATCATTCGGTCAAGCAGTGTCAGGCTTTGATTCTTGCCCCT
ACACGTGAGCTTGCTCAGCAAATCCAAAAAGTGGTCGTGGCCATTGGCGACTTCATGAATGTTGAATGCCATGCT
TGCATCGGTGGCACCAGCGTTCGCGACGACATGAAGGCCCTTCAGGATGGTCCCCAGGTTGTGGTGGGCACTCCT
GGTCGTGTCCACGACATGATTCAGCGTCGTTTTCTTCGTACCGATGCCATGAAGATGTTTGTTCTTGATGAGGCA
GATGAGATGCTCTCTCGAGGCTTCACGGACCAAATCTACGATATCTTCCAGCTGCTTCCACAGTCGACCCAAGTT
GTGTTGTTGTCTGCTACCATGCCTCAAGATGTCCTCGAGGTCACCACGCGCTTCATGCGTGACCCTGTTCGTATC
CTTGTTAAGAAGGACGAACTGACTCTTGAGGGTATCAAGCAATTTTACATTGCCGTCGAAAAAGAAGAGTGGAAA
CTTGACACCCTCTCTGATTTATACGAGACAGTCACCATCACCCAAGCAGTCATCTTTTGCAATACACGCAGAAAG
GTGGACTGGCTTACCGATAAGCTAACGGCTCGTGACTTCACCGTGTCAGCCATGCACGGAGATATGGACCAGGCG
CAACGCGACCTAATCATGAAGGAGTTCCGATCTGGTTCTTCTCGTGTCCTGATCGCGACTGATCTTCTGGCTCGT
GGAATCGACGTACAACAAGTTTCTCTCGTCATCAACTATGACTTGCCCGCCAATCGCGAAAATTATATCCATCGG
ATTGGTCGTGGCGGTCGATTTGGTCGCAAAGGTGTCGCGATCAACTTTGTCACGGCTGATGATGTTCGTATGATG
CGTGAGATTGAACAGTTTTACAGCACTCAGATTGAGGAGATGCCGATGAATGTTGCCGACCTCATTTAA
Gene >OphauB2|7659
ATGGCTACCGACAAGGGACTCGAGGATGTCCCTGAGGGTGAGTTGTTACTTCTTGGCATTTTCTTTGGCCCGCTC
TTGTTTGCTGGAGAAAAGGAGGCGAACAAAAGTTTTGCAATGGGCGTTTTACCCACAGATGCAGCTTCTCCTAAT
AACCCACACGCCTGCCTTCATAGCATACTGACCAACTCGGCCTACAGGACAAATCGAGTCCAACTATGACGAGAC
GGTTGACTCATTCGATGACATGAATCTCAAATCTGAGCTCCTTCGTGGCGGTGGGTTACCCTGGCCTTGGGCTCT
ACTGTCCAGTCCACAACACCCACCCGCTATTCTGCTGACACATGACCCAAAGTGTACGCATATGGCTTCGAGCGC
CCTTCTGCTATCCAGCAGCGTGCCATTATGCCCGTCATCAAGAGCCACGATGTTATTGCCCAGGCCCAATCTGGA
ACTGGCAAGACTGCCACATTCTCGATTTCGGTCCTGCAGAAGATCGATCATTCGGTCAAGCAGTGTCAGGCTTTG
ATTCTTGCCCCTACACGTGAGCTTGCTCAGCAAATCCAAAAAGTGGTCGTGGCCATTGGCGACTTCATGAATGTT
GAATGCCATGCTTGCATCGGTGGCACCAGCGTTCGCGACGACATGAAGGCCCTTCAGGATGGTCCCCAGGTTGTG
GTGGGCACTCCTGGTCGTGTCCACGACATGATTCAGCGTCGTTTTCTTCGTACCGATGCCATGAAGATGTTTGTT
CTTGATGAGGCAGATGAGATGCTCTCTGTAAATTGCCCCCCCCCACTCTCCCGTTTCTAAATACAAGACACTAAC
CTTGCCCAAGCGAGGCTTCACGGACCAAATCTACGATATCTTCCAGCTGCTTCCACAGTCGACCCAAGTTGTGTT
GTTGTCTGCTACCATGCCTCAAGATGTCCTCGAGGTCACCACGCGCTTCATGCGTGACCCTGTTCGTATCCTTGT
TAAGAAGGACGAACTGACTCTTGAGGGTATCAAGCAATTTTACATTGCCGTCGAAAAAGAAGAGTGGAAACTTGA
CACCCTCTCTGATTTATACGAGACAGTCACCATCACCCAAGCAGTCATCTTTTGCAATACACGCAGAAAGGTGGA
CTGGCTTACCGATAAGCTAACGGCTCGTGACTTCACCGTGTCAGCCATGCACGGAGATATGGACCAGGCGCAACG
CGACCTAATCATGAAGGAGTTCCGATCTGGTTCTTCTCGTGTCCTGATCGCGACTGATCTTCTGGCTCGTGGAAT
CGACGTACAACAAGTTTCTCTCGTCATCAACTATGACTTGCCCGCCAATCGCGAAAATTATATCCATCGGATTGG
TCGTGGCGGTCGATTTGGTCGCAAAGGTGTCGCGATCAACTTTGTCACGGCTGATGATGTTCGTATGATGCGTGA
GATTGAACAGTTTTACAGCACTCAGATTGAGGAGATGCCGATGAATGTTGCCGACCTCATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail