Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7656
Gene name
LocationContig_84:58894..60462
Strand+
Gene length (bp)1568
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17104 DUF5102 Domain of unknown function (DUF5102) 6.3E-109 204 482

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42882|YFQ5_SCHPO Uncharacterized protein C8E11.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8E11.05c PE=4 SV=1 296 481 9.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7656
MAHSESLESPPRAVLVEPGAHQLSESSDEEDQFTDAQSGPASPRGNPQGVKAPTSRVNDEIYSSQPTSPIPTTLA
HAAREQDAQPDQNSLVAQDNSREPRSSPPVPLSSIEKSGAETSCGQVPGIAAYSIDRSDAQPDQTPAVADESDNT
TPLATVTDHVPVTVLQDIPASEADDCPVAATETDTESNAALDETGQALHNHEDFGDEFDDFEEGAQDDDFDDFDD
GFQQPLHQETSTRTEPPSLLPFPILDLDGLVSDDIMTSTAPILDIIFPPESLNLSTPPSLPKDSSIFITPRSAPL
WSQLVAPPPLAPPDWIRSRTRRLFLVSLGVPVDLDEILPASKQKKLILPSLNATTASSRTSIDSRSVSQLRQGDV
NASSTSLDSQGQTISCGADSRRRKGPPPQPELDLVAARYLCTTTDEALNGMTDEELKDHIAKLESMQGAANSVLE
YWKKCADEKIGDREAFEGVIENLVKHARKVRK*
Coding >OphauB2|7656
ATGGCCCACTCTGAAAGCTTGGAGTCACCTCCACGCGCAGTTTTGGTCGAGCCTGGAGCCCATCAGCTATCCGAG
TCGTCTGACGAGGAAGACCAGTTTACAGATGCGCAGTCGGGTCCGGCCAGTCCGCGCGGGAATCCTCAAGGCGTA
AAAGCGCCAACTTCCCGGGTCAACGACGAAATTTACTCTAGTCAGCCCACAAGCCCAATTCCCACTACGCTGGCA
CATGCCGCTCGCGAACAAGACGCACAGCCAGACCAAAATTCGCTTGTTGCACAGGACAACTCTAGAGAGCCGCGC
AGCAGTCCCCCTGTGCCTTTATCCAGCATCGAAAAGAGTGGCGCAGAGACATCATGTGGCCAAGTGCCAGGAATC
GCGGCGTATAGCATAGACAGGAGCGATGCACAGCCTGACCAAACTCCCGCCGTCGCAGACGAGAGCGACAACACG
ACACCGCTTGCCACTGTCACGGACCATGTTCCGGTCACAGTACTACAGGATATCCCGGCTTCAGAGGCCGATGAC
TGTCCTGTTGCCGCCACTGAGACGGATACCGAATCTAATGCTGCCCTTGATGAGACTGGCCAGGCGCTACATAAT
CATGAAGACTTTGGTGATGAGTTTGACGATTTCGAAGAGGGCGCCCAGGACGATGATTTTGACGACTTTGATGAT
GGCTTTCAACAACCTCTGCATCAAGAGACGTCCACACGCACAGAACCGCCTTCATTATTACCATTTCCCATATTA
GACCTTGACGGTCTTGTGTCCGACGATATAATGACCTCTACCGCACCTATCCTTGACATTATTTTTCCTCCGGAG
TCGCTCAACCTGTCTACGCCTCCCTCGCTGCCAAAAGACTCATCCATCTTCATTACTCCTCGATCTGCGCCGCTA
TGGTCACAGCTTGTTGCTCCCCCGCCGCTTGCCCCTCCAGATTGGATCCGCTCTCGTACTCGTCGTCTTTTTCTC
GTCTCTCTAGGTGTTCCTGTTGACTTGGATGAAATTCTACCCGCTTCGAAACAAAAAAAGCTCATTTTGCCTTCG
CTCAACGCCACAACCGCCTCGTCCCGTACCTCCATCGACTCGCGCTCCGTGTCACAGCTGCGTCAAGGCGATGTC
AATGCTTCGTCCACTTCCCTCGACTCCCAAGGCCAAACAATATCTTGTGGTGCCGACTCTAGGAGACGCAAGGGC
CCGCCTCCGCAACCCGAGCTCGACCTCGTCGCAGCTCGCTATCTCTGCACCACAACTGACGAAGCACTCAATGGG
ATGACGGACGAGGAGCTCAAGGATCACATCGCAAAGTTAGAATCGATGCAAGGAGCTGCCAACAGTGTGCTAGAG
TATTGGAAGAAATGTGCCGATGAAAAAATTGGCGATCGTGAGGCGTTTGAGGGAGTCATAGAGAATCTAGTAAAG
CACGCGCGAAAAGTTCGCAAGTAG
Transcript >OphauB2|7656
ATGGCCCACTCTGAAAGCTTGGAGTCACCTCCACGCGCAGTTTTGGTCGAGCCTGGAGCCCATCAGCTATCCGAG
TCGTCTGACGAGGAAGACCAGTTTACAGATGCGCAGTCGGGTCCGGCCAGTCCGCGCGGGAATCCTCAAGGCGTA
AAAGCGCCAACTTCCCGGGTCAACGACGAAATTTACTCTAGTCAGCCCACAAGCCCAATTCCCACTACGCTGGCA
CATGCCGCTCGCGAACAAGACGCACAGCCAGACCAAAATTCGCTTGTTGCACAGGACAACTCTAGAGAGCCGCGC
AGCAGTCCCCCTGTGCCTTTATCCAGCATCGAAAAGAGTGGCGCAGAGACATCATGTGGCCAAGTGCCAGGAATC
GCGGCGTATAGCATAGACAGGAGCGATGCACAGCCTGACCAAACTCCCGCCGTCGCAGACGAGAGCGACAACACG
ACACCGCTTGCCACTGTCACGGACCATGTTCCGGTCACAGTACTACAGGATATCCCGGCTTCAGAGGCCGATGAC
TGTCCTGTTGCCGCCACTGAGACGGATACCGAATCTAATGCTGCCCTTGATGAGACTGGCCAGGCGCTACATAAT
CATGAAGACTTTGGTGATGAGTTTGACGATTTCGAAGAGGGCGCCCAGGACGATGATTTTGACGACTTTGATGAT
GGCTTTCAACAACCTCTGCATCAAGAGACGTCCACACGCACAGAACCGCCTTCATTATTACCATTTCCCATATTA
GACCTTGACGGTCTTGTGTCCGACGATATAATGACCTCTACCGCACCTATCCTTGACATTATTTTTCCTCCGGAG
TCGCTCAACCTGTCTACGCCTCCCTCGCTGCCAAAAGACTCATCCATCTTCATTACTCCTCGATCTGCGCCGCTA
TGGTCACAGCTTGTTGCTCCCCCGCCGCTTGCCCCTCCAGATTGGATCCGCTCTCGTACTCGTCGTCTTTTTCTC
GTCTCTCTAGGTGTTCCTGTTGACTTGGATGAAATTCTACCCGCTTCGAAACAAAAAAAGCTCATTTTGCCTTCG
CTCAACGCCACAACCGCCTCGTCCCGTACCTCCATCGACTCGCGCTCCGTGTCACAGCTGCGTCAAGGCGATGTC
AATGCTTCGTCCACTTCCCTCGACTCCCAAGGCCAAACAATATCTTGTGGTGCCGACTCTAGGAGACGCAAGGGC
CCGCCTCCGCAACCCGAGCTCGACCTCGTCGCAGCTCGCTATCTCTGCACCACAACTGACGAAGCACTCAATGGG
ATGACGGACGAGGAGCTCAAGGATCACATCGCAAAGTTAGAATCGATGCAAGGAGCTGCCAACAGTGTGCTAGAG
TATTGGAAGAAATGTGCCGATGAAAAAATTGGCGATCGTGAGGCGTTTGAGGGAGTCATAGAGAATCTAGTAAAG
CACGCGCGAAAAGTTCGCAAGTAG
Gene >OphauB2|7656
ATGGCCCACTCTGAAAGCTTGGAGTCACCTCCACGCGCAGTTTTGGTCGAGCCTGGAGCCCATCAGCTATGTCGG
TTCTCAGGCCTGTGCCAATTATGGCTCAAAATACTGACTCCTTTTCAGCCGAGTCGTCTGACGAGGAAGACCAGT
TTACAGATGCGCAGTCGGGTCCGGCCAGTCCGCGCGGGAATCCTCAAGGCGTAAAAGCGCCAACTTCCCGGGTCA
ACGACGAAATTTACTCTAGTCAGCCCACAAGCCCAATTCCCACTACGCTGGCACATGCCGCTCGCGAACAAGACG
CACAGCCAGACCAAAATTCGCTTGTTGCACAGGACAACTCTAGAGAGCCGCGCAGCAGTCCCCCTGTGCCTTTAT
CCAGCATCGAAAAGAGTGGCGCAGAGACATCATGTGGCCAAGTGCCAGGAATCGCGGCGTATAGCATAGACAGGA
GCGATGCACAGCCTGACCAAACTCCCGCCGTCGCAGACGAGAGCGACAACACGACACCGCTTGCCACTGTCACGG
ACCATGTTCCGGTCACAGTACTACAGGATATCCCGGCTTCAGAGGCCGATGACTGTCCTGTTGCCGCCACTGAGA
CGGATACCGAATCTAATGCTGCCCTTGATGAGACTGGCCAGGCGCTACATAATCATGAAGACTTTGGTGATGAGT
TTGACGATTTCGAAGAGGGCGCCCAGGACGATGATTTTGACGACTTTGATGATGGCTTTCAACAACCTCTGCATC
AAGAGACGTCCACACGCACAGAACCGCCTTCATTATTACCATTTGTAAGGGGCTCTGATTCCGTGACTTGATAAC
GTCACCAGCCGTTCTAATAAAGTTTTTGCCTTCAGCCCATATTAGACCTTGACGGTCTTGTGTCCGACGATATAA
TGACCTCTACCGCACCTATCCTTGACATTATTTTTCCTCCGGAGTCGCTCAACCTGTCTACGCCTCCCTCGCTGC
CAAAAGACTCATCCATCTTCATTACTCCTCGATCTGCGCCGCTATGGTCACAGCTTGTTGCTCCCCCGCCGCTTG
CCCCTCCAGATTGGATCCGCTCTCGTACTCGTCGTCTTTTTCTCGTCTCTCTAGGTGTTCCTGTTGACTTGGATG
AAATTCTACCCGCTTCGAAACAAAAAAAGCTCATTTTGCCTTCGCTCAACGCCACAACCGCCTCGTCCCGTACCT
CCATCGACTCGCGCTCCGTGTCACAGCTGCGTCAAGGCGATGTCAATGCTTCGTCCACTTCCCTCGACTCCCAAG
GCCAAACAATATCTTGTGGTGCCGACTCTAGGAGACGCAAGGGCCCGCCTCCGCAACCCGAGCTCGACCTCGTCG
CAGCTCGCTATCTCTGCACCACAACTGACGAAGCACTCAATGGGATGACGGACGAGGAGCTCAAGGATCACATCG
CAAAGTTAGAATCGATGCAAGGAGCTGCCAACAGTGTGCTAGAGTATTGGAAGAAATGTGCCGATGAAAAAATTG
GCGATCGTGAGGCGTTTGAGGGAGTCATAGAGAATCTAGTAAAGCACGCGCGAAAAGTTCGCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail