Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7647
Gene name
LocationContig_84:40900..41880
Strand+
Gene length (bp)980
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09130 DUF1932 Domain of unknown function (DUF1932) 2.5E-21 204 277
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 1.0E-08 12 136
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.6E-07 12 92

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21336|Y7SR_METFE Uncharacterized 28.5 kDa protein in 7S RNA 5'region OS=Methanothermus fervidus PE=4 SV=1 12 208 2.0E-09
sp|P0ABQ2|GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=garR PE=1 SV=1 12 142 3.0E-07
sp|P0ABQ3|GARR_ECOL6 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=garR PE=3 SV=1 12 142 3.0E-07

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7647
MQQEQQQEQVVVGILSMGDMGAGIAKLLMAQGMAVVTNCQDRSQETMARAREAGVRVLWSDRALVEECDVVMSIV
PPGKAEATADRVAQAAAGSGQCRISFYLDLNAVSPATSGRIEAAMGASGWIRFVDGCIIGGPPRRIDDGGAWWQP
SVPISGPHAASLPAALCRALGTRRIEGSASGLKMCFAGLAKGFTALATQTLTTACQLGLGDELAREMEALLPAHW
AAVQRGLPDMPPKAYRWVAEMDQIADTMRDNGAWPDDAAATFRGAAAVYRAVASQALPSHQSETRLTATQLAAAM
AQRLGP*
Coding >OphauB2|7647
ATGCAACAAGAGCAGCAGCAAGAACAAGTGGTAGTGGGCATACTGTCCATGGGAGACATGGGAGCTGGCATAGCC
AAGCTGCTCATGGCGCAGGGCATGGCGGTTGTGACCAACTGCCAGGACAGAAGTCAAGAGACGATGGCTCGGGCA
AGGGAAGCGGGCGTCAGGGTGCTATGGTCGGACAGGGCGCTGGTGGAGGAGTGCGACGTCGTCATGTCGATTGTG
CCGCCGGGCAAGGCAGAGGCGACGGCAGACAGAGTGGCCCAGGCGGCGGCAGGCAGCGGGCAGTGCCGCATCAGC
TTCTACCTTGATTTGAACGCCGTGTCGCCGGCAACGAGCGGGCGCATCGAGGCCGCCATGGGGGCGTCGGGCTGG
ATTCGCTTCGTCGACGGATGCATCATTGGCGGGCCGCCTCGGCGAATAGACGACGGGGGCGCATGGTGGCAGCCC
AGCGTTCCCATCTCGGGCCCGCACGCAGCGTCTCTGCCGGCGGCGCTGTGCAGGGCGTTGGGGACGCGGCGCATC
GAGGGCAGTGCCAGCGGGCTCAAGATGTGCTTTGCCGGACTGGCCAAGGGCTTCACGGCGCTGGCGACGCAGACG
CTGACGACGGCCTGCCAGCTGGGCCTGGGCGACGAGCTGGCCCGCGAGATGGAGGCGCTGCTGCCGGCGCACTGG
GCGGCGGTGCAGCGCGGCCTGCCCGACATGCCGCCCAAGGCATACCGCTGGGTGGCCGAGATGGACCAGATTGCC
GACACCATGCGTGACAATGGCGCCTGGCCCGACGACGCCGCCGCCACCTTTCGCGGCGCCGCAGCCGTCTATCGC
GCCGTGGCCAGCCAAGCACTCCCGAGCCACCAGTCCGAGACGCGCTTGACTGCCACCCAGCTTGCTGCCGCCATG
GCACAGCGCCTGGGCCCCTAG
Transcript >OphauB2|7647
ATGCAACAAGAGCAGCAGCAAGAACAAGTGGTAGTGGGCATACTGTCCATGGGAGACATGGGAGCTGGCATAGCC
AAGCTGCTCATGGCGCAGGGCATGGCGGTTGTGACCAACTGCCAGGACAGAAGTCAAGAGACGATGGCTCGGGCA
AGGGAAGCGGGCGTCAGGGTGCTATGGTCGGACAGGGCGCTGGTGGAGGAGTGCGACGTCGTCATGTCGATTGTG
CCGCCGGGCAAGGCAGAGGCGACGGCAGACAGAGTGGCCCAGGCGGCGGCAGGCAGCGGGCAGTGCCGCATCAGC
TTCTACCTTGATTTGAACGCCGTGTCGCCGGCAACGAGCGGGCGCATCGAGGCCGCCATGGGGGCGTCGGGCTGG
ATTCGCTTCGTCGACGGATGCATCATTGGCGGGCCGCCTCGGCGAATAGACGACGGGGGCGCATGGTGGCAGCCC
AGCGTTCCCATCTCGGGCCCGCACGCAGCGTCTCTGCCGGCGGCGCTGTGCAGGGCGTTGGGGACGCGGCGCATC
GAGGGCAGTGCCAGCGGGCTCAAGATGTGCTTTGCCGGACTGGCCAAGGGCTTCACGGCGCTGGCGACGCAGACG
CTGACGACGGCCTGCCAGCTGGGCCTGGGCGACGAGCTGGCCCGCGAGATGGAGGCGCTGCTGCCGGCGCACTGG
GCGGCGGTGCAGCGCGGCCTGCCCGACATGCCGCCCAAGGCATACCGCTGGGTGGCCGAGATGGACCAGATTGCC
GACACCATGCGTGACAATGGCGCCTGGCCCGACGACGCCGCCGCCACCTTTCGCGGCGCCGCAGCCGTCTATCGC
GCCGTGGCCAGCCAAGCACTCCCGAGCCACCAGTCCGAGACGCGCTTGACTGCCACCCAGCTTGCTGCCGCCATG
GCACAGCGCCTGGGCCCCTAG
Gene >OphauB2|7647
ATGCAACAAGAGCAGCAGCAAGAACAAGTGGTAGTGGGCATACTGTCCATGGGAGACATGGGAGCTGGCATAGCC
AAGCTGCTCATGGCGCAGGGCATGGCGGTTGTGACCAACTGCCAGGACAGAAGGTGTGCCTCGGCTTGATGTTGC
AGGAATTGGCGGTCGGCCACTGACCAAAGGCTGGCAGTCAAGAGACGATGGCTCGGGCAAGGGAAGCGGGCGTCA
GGGTGCTATGGTCGGACAGGGCGCTGGTGGAGGAGTGCGACGTCGTCATGTCGATTGTGCCGCCGGGCAAGGCAG
AGGCGACGGCAGACAGAGTGGCCCAGGCGGCGGCAGGCAGCGGGCAGTGCCGCATCAGCTTCTACCTTGATTTGA
ACGCCGTGTCGCCGGCAACGAGCGGGCGCATCGAGGCCGCCATGGGGGCGTCGGGCTGGATTCGCTTCGTCGACG
GATGCATCATTGGCGGGCCGCCTCGGCGAATAGACGACGGGGGCGCATGGTGGCAGCCCAGCGTTCCCATCTCGG
GCCCGCACGCAGCGTCTCTGCCGGCGGCGCTGTGCAGGGCGTTGGGGACGCGGCGCATCGAGGGCAGTGCCAGCG
GGCTCAAGATGTGCTTTGCCGGACTGGCCAAGGGCTTCACGGCGCTGGCGACGCAGACGCTGACGACGGCCTGCC
AGCTGGGCCTGGGCGACGAGCTGGCCCGCGAGATGGAGGCGCTGCTGCCGGCGCACTGGGCGGCGGTGCAGCGCG
GCCTGCCCGACATGCCGCCCAAGGCATACCGCTGGGTGGCCGAGATGGACCAGATTGCCGACACCATGCGTGACA
ATGGCGCCTGGCCCGACGACGCCGCCGCCACCTTTCGCGGCGCCGCAGCCGTCTATCGCGCCGTGGCCAGCCAAG
CACTCCCGAGCCACCAGTCCGAGACGCGCTTGACTGCCACCCAGCTTGCTGCCGCCATGGCACAGCGCCTGGGCC
CCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail