Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7646
Gene name
LocationContig_84:39090..40599
Strand+
Gene length (bp)1509
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.3E-17 92 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 1 162 4.0E-16
sp|Q9JJW6|ALRF2_MOUSE Aly/REF export factor 2 OS=Mus musculus GN=Alyref2 PE=1 SV=1 1 170 5.0E-15
sp|Q9URV0|YBLC_SCHPO Uncharacterized RNA-binding protein C106.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.12c PE=3 SV=1 5 160 3.0E-11
sp|Q8L719|THO4B_ARATH THO complex subunit 4B OS=Arabidopsis thaliana GN=ALY2 PE=1 SV=1 54 177 6.0E-11
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 86 164 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 1 162 4.0E-16
sp|Q9JJW6|ALRF2_MOUSE Aly/REF export factor 2 OS=Mus musculus GN=Alyref2 PE=1 SV=1 1 170 5.0E-15
sp|Q9URV0|YBLC_SCHPO Uncharacterized RNA-binding protein C106.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.12c PE=3 SV=1 5 160 3.0E-11
sp|Q8L719|THO4B_ARATH THO complex subunit 4B OS=Arabidopsis thaliana GN=ALY2 PE=1 SV=1 54 177 6.0E-11
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 86 164 1.0E-10
sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 86 164 1.0E-10
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 88 164 9.0E-10
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 88 164 1.0E-09
sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 88 164 1.0E-09
sp|Q6NQ72|THO4D_ARATH THO complex subunit 4D OS=Arabidopsis thaliana GN=ALY4 PE=1 SV=1 86 162 1.0E-09
sp|Q6GLW1|THO4B_XENLA THO complex subunit 4-B OS=Xenopus laevis GN=alyref-b PE=2 SV=1 86 164 1.0E-09
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 86 157 2.0E-09
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 87 161 8.0E-09
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 85 161 1.0E-08
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 1 164 1.0E-08
sp|Q94EH8|THO4C_ARATH THO complex subunit 4C OS=Arabidopsis thaliana GN=ALY3 PE=1 SV=1 86 166 1.0E-07
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 87 159 1.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 54 161 1.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 50 161 1.0E-07
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 87 159 1.0E-07
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 87 159 1.0E-07
sp|Q12159|YRA1_YEAST RNA annealing protein YRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YRA1 PE=1 SV=2 1 187 2.0E-07
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 93 171 2.0E-07
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 99 157 2.0E-07
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 99 157 2.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 93 149 3.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 93 149 3.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 93 149 3.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 93 149 3.0E-07
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 93 157 3.0E-07
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 82 149 4.0E-07
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 93 171 5.0E-07
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 60 161 5.0E-07
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 88 157 5.0E-07
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 88 157 5.0E-07
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 92 159 6.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 87 159 6.0E-07
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 87 159 6.0E-07
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 87 159 6.0E-07
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 87 159 6.0E-07
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 81 161 6.0E-07
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 88 157 7.0E-07
sp|Q09330|MLO3_SCHPO mRNA export protein mlo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo3 PE=1 SV=1 1 149 7.0E-07
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 87 159 8.0E-07
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 87 159 9.0E-07
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 59 168 9.0E-07
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 85 157 9.0E-07
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 72 160 9.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 86 161 9.0E-07
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 88 157 1.0E-06
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 40 197 1.0E-06
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 85 157 1.0E-06
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 84 165 1.0E-06
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 93 168 1.0E-06
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 88 157 1.0E-06
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 88 157 1.0E-06
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 88 157 1.0E-06
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 87 161 2.0E-06
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 88 157 2.0E-06
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 88 157 2.0E-06
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 88 157 2.0E-06
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 88 157 2.0E-06
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 87 159 2.0E-06
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 99 157 3.0E-06
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 81 169 3.0E-06
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 88 161 3.0E-06
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 99 157 3.0E-06
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 99 157 3.0E-06
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 99 157 3.0E-06
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 88 157 4.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 81 161 4.0E-06
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 87 159 4.0E-06
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 87 159 4.0E-06
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 87 159 4.0E-06
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 87 159 4.0E-06
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 87 159 4.0E-06
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 87 159 4.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 88 157 5.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 88 157 5.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 88 157 5.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 88 157 5.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 88 157 5.0E-06
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 87 157 6.0E-06
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 93 154 7.0E-06
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 85 235 7.0E-06
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 93 154 7.0E-06
sp|O02008|TRA2_DROVI Transformer-2 sex-determining protein OS=Drosophila virilis GN=tra2 PE=3 SV=1 69 184 9.0E-06
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 87 149 9.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 73 159 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7646
MANKMDRGLDEIIADTRRSGPRTRRGGDGRRDRHDNYPRDGVRKSTREHHRGIDSEWVHDRYEDNNSRRTAPRRQ
REMPYVSEPRGSKLKAENIHYDLTEDDLDELFTRIGPVTRLQLLYDRAGRSEGTAFVTYESRDDAKEAIRQFDGA
NANGQPIYLSLLHSAPSRNPFDTAHMPSRPLAERISAPKGRSRSWSPHGRQDDDDEASSRKGIDRYTPGGARRSR
SPMQRGRGGRRPGVRRDGHNRDEQSTRGGRANMRSKKTQDELDAEMEDYFAGNSALSAGADGESSNKAGGVAASE
DVDMIG*
Coding >OphauB2|7646
ATGGCTAACAAGATGGACCGCGGCCTTGACGAAATCATTGCCGACACGCGCAGAAGCGGCCCTCGAACTCGACGC
GGCGGCGATGGCCGTCGCGACCGCCACGACAACTATCCCCGTGACGGCGTCAGAAAGTCTACTCGCGAACATCAT
CGTGGCATTGATAGCGAATGGGTTCATGATCGTTACGAAGACAACAACTCTAGAAGAACTGCCCCTCGACGACAG
CGCGAGATGCCCTATGTCAGCGAACCCCGGGGTTCTAAACTCAAAGCTGAAAACATACATTACGACCTTACCGAA
GACGATCTTGATGAACTCTTTACGAGGATTGGCCCTGTCACACGGCTGCAACTACTTTACGACCGGGCTGGACGA
TCCGAGGGCACCGCTTTCGTGACGTACGAGAGCAGAGATGATGCTAAAGAGGCAATCAGACAGTTTGACGGAGCC
AATGCCAATGGGCAACCGATATACTTGAGCTTGTTGCACAGCGCGCCATCACGCAATCCCTTTGATACGGCTCAC
ATGCCAAGTCGCCCTCTGGCAGAGAGAATCTCGGCGCCCAAAGGCCGCTCTCGCTCGTGGTCTCCGCATGGACGA
CAAGATGACGACGACGAAGCTTCCTCGCGCAAGGGCATTGACAGGTATACGCCGGGGGGTGCCAGGCGTTCAAGA
AGCCCGATGCAGAGGGGCCGTGGAGGTCGTCGGCCAGGCGTTCGGCGCGATGGTCACAACAGAGATGAGCAGAGC
ACTCGTGGCGGTCGAGCCAACATGCGCTCCAAGAAGACACAGGATGAATTGGATGCGGAGATGGAGGACTATTTT
GCAGGAAACAGTGCTCTGTCGGCAGGCGCTGATGGCGAGAGTTCGAACAAGGCTGGGGGGGTAGCAGCCAGCGAG
GATGTCGACATGATTGGGTAA
Transcript >OphauB2|7646
ATGGCTAACAAGATGGACCGCGGCCTTGACGAAATCATTGCCGACACGCGCAGAAGCGGCCCTCGAACTCGACGC
GGCGGCGATGGCCGTCGCGACCGCCACGACAACTATCCCCGTGACGGCGTCAGAAAGTCTACTCGCGAACATCAT
CGTGGCATTGATAGCGAATGGGTTCATGATCGTTACGAAGACAACAACTCTAGAAGAACTGCCCCTCGACGACAG
CGCGAGATGCCCTATGTCAGCGAACCCCGGGGTTCTAAACTCAAAGCTGAAAACATACATTACGACCTTACCGAA
GACGATCTTGATGAACTCTTTACGAGGATTGGCCCTGTCACACGGCTGCAACTACTTTACGACCGGGCTGGACGA
TCCGAGGGCACCGCTTTCGTGACGTACGAGAGCAGAGATGATGCTAAAGAGGCAATCAGACAGTTTGACGGAGCC
AATGCCAATGGGCAACCGATATACTTGAGCTTGTTGCACAGCGCGCCATCACGCAATCCCTTTGATACGGCTCAC
ATGCCAAGTCGCCCTCTGGCAGAGAGAATCTCGGCGCCCAAAGGCCGCTCTCGCTCGTGGTCTCCGCATGGACGA
CAAGATGACGACGACGAAGCTTCCTCGCGCAAGGGCATTGACAGGTATACGCCGGGGGGTGCCAGGCGTTCAAGA
AGCCCGATGCAGAGGGGCCGTGGAGGTCGTCGGCCAGGCGTTCGGCGCGATGGTCACAACAGAGATGAGCAGAGC
ACTCGTGGCGGTCGAGCCAACATGCGCTCCAAGAAGACACAGGATGAATTGGATGCGGAGATGGAGGACTATTTT
GCAGGAAACAGTGCTCTGTCGGCAGGCGCTGATGGCGAGAGTTCGAACAAGGCTGGGGGGGTAGCAGCCAGCGAG
GATGTCGACATGATTGGGTAA
Gene >OphauB2|7646
ATGGCTAACAAGATGGACCGCGGCCTTGACGAAATCATTGCCGACACGGTATGTTTATTTACTGACTCTTGGCCA
TCTCAAGTCTGGCTAACAAGCATTCGCCGCTGGCAGCGCAGAAGCGGCCCTCGAACTCGACGCGGCGGCGATGGC
CGTCGCGACCGCCACGACAACTATCCCCGTGACGGCGTCAGAAAGGTCCGTCTGTCTTTGGGCCCCTGCGTCTAG
CAGGAAGCTCGGCAAAAAGCCTACGTCGATAGTGGCTCGCCACGAGATGAAATGGTGGTTCATGGGTCTCGGGCT
CGAGCAGTTCTTCCTTGCATATATACCTATGGCTTCTCGGGTCCTCGGCGACACCACCTGGATCTCATGCGTGCA
GTCTGATTGGCTAACATGTGCCTCGTCTGTTGGGAACAGTCTACTCGCGAACATCATCGTGGCATTGATAGGTGA
GAAGTCATGAGCAGACGATATCAAGAGAGTGCAGCCTGGAAGCTGCTAACGCTTTGTGTAGCGAATGGGTTCATG
ATCGTTACGAAGACAACAGTAGGATCGCCAGGACCTCAGGCCGTTGAAATCGGGCTCATAAGCCTCAATTGGCAT
AGACTCTAGAAGAACTGCCCCTCGACGACAGCGCGAGATGCCCTATGTCAGGTGAGCATTTGGGCCCAAGATGTC
TTGGGCTTGGAGCTGATGAGCTGCGCTGCCAGCGAACCCCGGGGTTCTAAACTCAAAGCTGAAAACATACATTAC
GACCTTACCGAAGACGATCTTGATGTACGGCATACAATGCTCCTTAGCGTTGCTCATCGTGTTGCACAATCCACT
AACCATGGCGCAAGGAACTCTTTACGAGGATTGGCCCTGTCACACGGCTGCAACTACTTTACGACCGGGCTGGAC
GATCCGAGGGCACCGCTTTCGTGACGTACGAGAGCAGAGATGATGCTAAAGAGGCAATCAGACAGTTTGACGGAG
CCAATGCCAATGGTTTGTCATTTGTCGACTTGGAAAGGACGAGAAGCAACGGCTAATAGGCAAGCTTGTTCAGGG
CAACCGATATACTTGAGCTTGTTGCACAGCGCGCCATCACGCAATCCCTTTGATACGGCTCACATGCCAAGTCGC
CCTCTGGCAGAGAGAATCTCGGCGCCCAAAGGCCGCTCTCGCTCGTGGTCTCCGCATGGACGACAAGATGACGAC
GACGAAGCTTCCTCGCGCAAGGGCATTGACAGGTATACGCCGGGGGGTGCCAGGCGTTCAAGAAGCCCGATGCAG
AGGGGCCGTGGAGGTCGTCGGCCAGGCGTTCGGCGCGATGGTCACAACAGAGATGAGCAGAGCACTCGTGGCGGT
CGAGCCAACATGCGCTCCAAGAAGACACAGGATGAATTGGATGCGGAGATGGAGGACTATTTTGCAGGAAACAGT
GCTCTGTCGGCAGGCGCTGATGGCGAGAGTTCGAACAAGGCTGGGGGGGTAGCAGCCAGCGAGGATGTCGACATG
ATTGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail