Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7642
Gene name
LocationContig_84:33401..33744
Strand+
Gene length (bp)343
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03208 PRA1 PRA1 family protein 4.7E-17 32 84

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53633|PRA1_YEAST Prenylated Rab acceptor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP3 PE=1 SV=2 16 82 7.0E-16
sp|Q9UUN5|PRA1_SCHPO PRA1-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC306.02c PE=2 SV=1 34 84 2.0E-11
sp|Q8HY39|PRAF1_CANLF Prenylated Rab acceptor protein 1 OS=Canis lupus familiaris GN=RABAC1 PE=2 SV=1 29 84 1.0E-06
sp|Q9UI14|PRAF1_HUMAN Prenylated Rab acceptor protein 1 OS=Homo sapiens GN=RABAC1 PE=1 SV=1 29 84 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7642
MSRIQVPLDVLTSRLNIGQRFQGLRAGPLTGRFSNLRPMSEFFDFKRLSKPANFGDMQSRVNYNLSHFSSNYAVV
FAMLSIYALGATLK*
Coding >OphauB2|7642
ATGTCTCGCATCCAGGTTCCCCTCGACGTCCTGACGTCGCGCCTCAACATTGGCCAACGCTTCCAGGGCCTACGA
GCTGGCCCCCTGACGGGCCGCTTCTCCAACCTGCGCCCCATGTCCGAGTTCTTTGACTTCAAACGCCTCTCCAAG
CCTGCAAACTTTGGTGACATGCAATCGCGTGTCAACTACAACCTCAGCCACTTTTCAAGCAACTATGCCGTCGTC
TTTGCCATGCTGAGCATCTATGCCTTGGGCGCGACCTTGAAATAG
Transcript >OphauB2|7642
ATGTCTCGCATCCAGGTTCCCCTCGACGTCCTGACGTCGCGCCTCAACATTGGCCAACGCTTCCAGGGCCTACGA
GCTGGCCCCCTGACGGGCCGCTTCTCCAACCTGCGCCCCATGTCCGAGTTCTTTGACTTCAAACGCCTCTCCAAG
CCTGCAAACTTTGGTGACATGCAATCGCGTGTCAACTACAACCTCAGCCACTTTTCAAGCAACTATGCCGTCGTC
TTTGCCATGCTGAGCATCTATGCCTTGGGCGCGACCTTGAAATAG
Gene >OphauB2|7642
ATGTCTCGCATCCAGGTTCCCCTCGACGTCCTGACGTCGCGCCTCAACATTGGCCAACGCTTCCAGGGCCTACGA
GCTGGCCCCCTGACGGGCCGCTTCTCCAACCTGCGCCCCATGTCCGAGTTCTTTGACTTCAAACGCCTCTCCAAG
CCTGCAAACTTTGGTGACATGCAATCGCGTGTCAACTACAACCTCAGCCACTTTTCAAGCAACTATGCCGTCGTC
TTTGCCATGCTGAGCATCTATGCCTTGTTGACCAACTGGCTGCTGCTCTTTGATATTGTCCTGGTCCTGGCCGGC
ATGTTCCTTATTGGCCGCCTCGAGGGGCGCGACCTTGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail