Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7641
Gene name
LocationContig_84:30018..32100
Strand+
Gene length (bp)2082
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04727 ELMO_CED12 ELMO/CED-12 family 1.7E-44 239 422
PF16457 PH_12 Pleckstrin homology domain 2.1E-37 493 636
PF11841 ELMO_ARM ELMO, armadillo-like helical domain 1.0E-13 37 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 9 674 6.0E-26
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 9 693 1.0E-25
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 9 674 1.0E-25
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 9 693 3.0E-25
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 9 674 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 9 674 6.0E-26
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 9 693 1.0E-25
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 9 674 1.0E-25
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 9 693 3.0E-25
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 9 674 1.0E-24
sp|Q96BJ8|ELMO3_HUMAN Engulfment and cell motility protein 3 OS=Homo sapiens GN=ELMO3 PE=1 SV=3 9 663 9.0E-24
sp|Q8BHL5|ELMO2_MOUSE Engulfment and cell motility protein 2 OS=Mus musculus GN=Elmo2 PE=1 SV=1 9 674 2.0E-23
sp|Q8BYZ7|ELMO3_MOUSE Engulfment and cell motility protein 3 OS=Mus musculus GN=Elmo3 PE=1 SV=2 9 588 1.0E-21
sp|Q499U2|ELMO3_RAT Engulfment and cell motility protein 3 OS=Rattus norvegicus GN=Elmo3 PE=2 SV=1 9 663 2.0E-21
sp|A6QR40|ELMO3_BOVIN Engulfment and cell motility protein 3 OS=Bos taurus GN=ELMO3 PE=2 SV=1 9 588 7.0E-19
sp|Q54YW1|ELMOA_DICDI ELMO domain-containing protein A OS=Dictyostelium discoideum GN=elmoA PE=1 SV=1 17 370 2.0E-11
sp|Q1ZXK2|FORG_DICDI Formin-G OS=Dictyostelium discoideum GN=forG PE=1 SV=1 15 208 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7641
MDQADVPALLSRLSSDDDAARKMAVFKLQTCINDPAFADVFMSSGGLIVLRRLILDSGGNTLAYSLQSLARLLEL
DMGWDIFKGATSTDLVERVVELIVTNPLVNILRGAMSILVALVSHSQSDATDAVFGFRGLKPAVAVFPQFFELVI
QQLDSADHALCANALMLINALLRDALGASASATDGAWSSGTTGDDWAKFVKRLQDLGLVQAVYRLMQSSSIQDLV
HPLLEFQSLSKSVIAKWRHVRVDLGDAQHRRLLKSIHAASAPEANGSLEQWQTQAAQEHQGQHKAEKWSRLGFSS
ESPGQDFEQTGFLGMMDLSDYAGRHEDAFQKLLLEQAAKPVAQRCPVARASLAVTAILYQDFDMDKADVDDAKAH
DSTDAKEHDSLFRPLLLQWSRLHTAGLQAFVRIWKSTGAEQDDFEKVAELTRILVEQVVGQASRTRSIAQVEDEM
LEYETARLRQVQMELLERAFEATWGRHLDQARQVLKHEALQFVKEQRVRCLLQGAWFTKPTAAGQERWRYAKLSH
NRRFLHYADFEGRMAQDPGLDSLADKVDLSSISSVVSNVSAPSDEATAQQGAATTKITVYSLAQPEAQPEAQQEA
QQEAQQEAHEEALLTLWPTSPSLASEWLDGLLMLLNQAPITAETSKLIHLISDYGLKIRLLNVRLDTAFEGPSPE
AGVVPSREGLDSDYYFDV*
Coding >OphauB2|7641
ATGGATCAAGCAGACGTGCCGGCGCTGCTGTCGCGACTGTCGAGCGACGATGACGCTGCGCGCAAAATGGCCGTC
TTCAAACTGCAGACATGCATCAACGACCCAGCATTTGCCGATGTCTTCATGTCGAGCGGCGGGCTCATTGTGCTG
CGGCGGCTGATTCTCGACTCGGGCGGCAACACGCTGGCCTATTCGCTGCAGAGTCTTGCTCGCCTGCTCGAGCTG
GACATGGGCTGGGACATATTCAAGGGCGCCACGTCGACGGACCTTGTTGAGCGAGTGGTTGAGCTCATTGTCACC
AATCCCCTGGTTAACATCCTCCGTGGCGCAATGTCCATTCTCGTTGCCCTCGTCAGCCATTCCCAGTCGGATGCG
ACCGACGCCGTCTTTGGCTTCCGCGGCCTCAAGCCCGCCGTTGCCGTCTTTCCTCAGTTTTTCGAGCTCGTCATC
CAGCAGCTCGACAGTGCCGACCACGCCCTGTGCGCAAACGCCCTCATGCTCATCAACGCTCTGCTGCGCGACGCC
CTGGGCGCATCGGCCAGTGCCACCGACGGCGCCTGGAGCAGCGGCACCACGGGCGACGACTGGGCCAAGTTTGTC
AAGCGCTTGCAGGACTTGGGCCTGGTGCAGGCTGTCTATAGGCTCATGCAGAGCTCTTCCATCCAGGACCTGGTG
CATCCGCTGCTCGAGTTCCAGTCGCTGAGCAAAAGCGTCATAGCCAAATGGCGCCACGTCAGAGTCGACCTTGGC
GATGCCCAACACCGGCGCTTGCTCAAGAGCATCCACGCCGCGAGCGCCCCCGAAGCCAACGGCAGCTTGGAGCAA
TGGCAGACGCAGGCGGCCCAAGAGCACCAAGGCCAGCACAAGGCTGAGAAATGGAGCCGGCTGGGCTTCTCGAGC
GAGAGCCCGGGCCAAGACTTTGAACAGACGGGCTTCCTGGGCATGATGGACTTGAGCGACTATGCCGGCAGACAC
GAGGATGCCTTTCAAAAGCTGCTGCTCGAGCAGGCCGCCAAGCCCGTGGCCCAACGCTGTCCCGTTGCCCGCGCC
AGCCTGGCCGTGACGGCGATTCTTTACCAAGACTTTGACATGGACAAGGCCGACGTCGACGATGCCAAGGCCCAT
GACAGCACCGACGCCAAGGAGCACGACTCGCTCTTCCGGCCGCTCTTGCTGCAGTGGTCACGGCTGCACACGGCT
GGCCTGCAGGCCTTTGTCCGCATATGGAAGTCGACGGGCGCCGAGCAAGACGACTTTGAAAAGGTGGCTGAACTG
ACGCGCATCCTGGTTGAGCAGGTGGTGGGCCAGGCCAGCCGCACCAGAAGCATTGCCCAGGTCGAGGACGAGATG
CTCGAGTACGAGACTGCGCGCCTGCGCCAAGTGCAGATGGAGCTGCTGGAGCGTGCCTTTGAGGCCACTTGGGGC
CGGCACCTGGATCAGGCCCGGCAGGTGCTCAAGCACGAGGCGCTGCAGTTTGTCAAGGAGCAGCGAGTGCGCTGC
CTGCTGCAAGGAGCCTGGTTCACCAAGCCCACAGCCGCCGGCCAGGAGCGCTGGAGATATGCCAAGCTGTCGCAC
AATCGGCGCTTCCTGCACTACGCCGACTTTGAAGGCCGCATGGCCCAAGATCCCGGCCTCGACAGCCTGGCAGAC
AAGGTGGACCTGAGCAGCATAAGCTCCGTCGTGTCCAACGTGTCTGCCCCCAGCGACGAGGCGACGGCGCAGCAG
GGCGCAGCAACGACCAAGATCACCGTGTACAGCCTGGCCCAGCCAGAGGCCCAGCCAGAGGCCCAGCAAGAGGCC
CAGCAAGAGGCCCAGCAAGAGGCCCATGAAGAGGCCCTTCTGACGCTCTGGCCTACAAGCCCCAGCCTGGCATCC
GAGTGGCTCGATGGGCTGCTGATGCTGCTCAACCAAGCACCCATAACAGCCGAGACGAGCAAGCTCATTCATCTC
ATTAGCGACTATGGCTTGAAGATTCGACTGCTCAATGTGCGTCTGGATACAGCGTTTGAAGGGCCATCGCCAGAG
GCAGGCGTGGTGCCGAGTCGCGAGGGGCTTGATAGCGACTATTACTTTGACGTCTAA
Transcript >OphauB2|7641
ATGGATCAAGCAGACGTGCCGGCGCTGCTGTCGCGACTGTCGAGCGACGATGACGCTGCGCGCAAAATGGCCGTC
TTCAAACTGCAGACATGCATCAACGACCCAGCATTTGCCGATGTCTTCATGTCGAGCGGCGGGCTCATTGTGCTG
CGGCGGCTGATTCTCGACTCGGGCGGCAACACGCTGGCCTATTCGCTGCAGAGTCTTGCTCGCCTGCTCGAGCTG
GACATGGGCTGGGACATATTCAAGGGCGCCACGTCGACGGACCTTGTTGAGCGAGTGGTTGAGCTCATTGTCACC
AATCCCCTGGTTAACATCCTCCGTGGCGCAATGTCCATTCTCGTTGCCCTCGTCAGCCATTCCCAGTCGGATGCG
ACCGACGCCGTCTTTGGCTTCCGCGGCCTCAAGCCCGCCGTTGCCGTCTTTCCTCAGTTTTTCGAGCTCGTCATC
CAGCAGCTCGACAGTGCCGACCACGCCCTGTGCGCAAACGCCCTCATGCTCATCAACGCTCTGCTGCGCGACGCC
CTGGGCGCATCGGCCAGTGCCACCGACGGCGCCTGGAGCAGCGGCACCACGGGCGACGACTGGGCCAAGTTTGTC
AAGCGCTTGCAGGACTTGGGCCTGGTGCAGGCTGTCTATAGGCTCATGCAGAGCTCTTCCATCCAGGACCTGGTG
CATCCGCTGCTCGAGTTCCAGTCGCTGAGCAAAAGCGTCATAGCCAAATGGCGCCACGTCAGAGTCGACCTTGGC
GATGCCCAACACCGGCGCTTGCTCAAGAGCATCCACGCCGCGAGCGCCCCCGAAGCCAACGGCAGCTTGGAGCAA
TGGCAGACGCAGGCGGCCCAAGAGCACCAAGGCCAGCACAAGGCTGAGAAATGGAGCCGGCTGGGCTTCTCGAGC
GAGAGCCCGGGCCAAGACTTTGAACAGACGGGCTTCCTGGGCATGATGGACTTGAGCGACTATGCCGGCAGACAC
GAGGATGCCTTTCAAAAGCTGCTGCTCGAGCAGGCCGCCAAGCCCGTGGCCCAACGCTGTCCCGTTGCCCGCGCC
AGCCTGGCCGTGACGGCGATTCTTTACCAAGACTTTGACATGGACAAGGCCGACGTCGACGATGCCAAGGCCCAT
GACAGCACCGACGCCAAGGAGCACGACTCGCTCTTCCGGCCGCTCTTGCTGCAGTGGTCACGGCTGCACACGGCT
GGCCTGCAGGCCTTTGTCCGCATATGGAAGTCGACGGGCGCCGAGCAAGACGACTTTGAAAAGGTGGCTGAACTG
ACGCGCATCCTGGTTGAGCAGGTGGTGGGCCAGGCCAGCCGCACCAGAAGCATTGCCCAGGTCGAGGACGAGATG
CTCGAGTACGAGACTGCGCGCCTGCGCCAAGTGCAGATGGAGCTGCTGGAGCGTGCCTTTGAGGCCACTTGGGGC
CGGCACCTGGATCAGGCCCGGCAGGTGCTCAAGCACGAGGCGCTGCAGTTTGTCAAGGAGCAGCGAGTGCGCTGC
CTGCTGCAAGGAGCCTGGTTCACCAAGCCCACAGCCGCCGGCCAGGAGCGCTGGAGATATGCCAAGCTGTCGCAC
AATCGGCGCTTCCTGCACTACGCCGACTTTGAAGGCCGCATGGCCCAAGATCCCGGCCTCGACAGCCTGGCAGAC
AAGGTGGACCTGAGCAGCATAAGCTCCGTCGTGTCCAACGTGTCTGCCCCCAGCGACGAGGCGACGGCGCAGCAG
GGCGCAGCAACGACCAAGATCACCGTGTACAGCCTGGCCCAGCCAGAGGCCCAGCCAGAGGCCCAGCAAGAGGCC
CAGCAAGAGGCCCAGCAAGAGGCCCATGAAGAGGCCCTTCTGACGCTCTGGCCTACAAGCCCCAGCCTGGCATCC
GAGTGGCTCGATGGGCTGCTGATGCTGCTCAACCAAGCACCCATAACAGCCGAGACGAGCAAGCTCATTCATCTC
ATTAGCGACTATGGCTTGAAGATTCGACTGCTCAATGTGCGTCTGGATACAGCGTTTGAAGGGCCATCGCCAGAG
GCAGGCGTGGTGCCGAGTCGCGAGGGGCTTGATAGCGACTATTACTTTGACGTCTAA
Gene >OphauB2|7641
ATGGATCAAGCAGACGTGCCGGCGCTGCTGTCGCGACTGTCGAGCGACGATGACGCTGCGCGCAAAATGGCCGTC
TTCAAACTGCAGACATGCATCAACGACCCAGCATTTGCCGATGTCTTCATGTCGAGCGGCGGGCTCATTGTGCTG
CGGCGGCTGATTCTCGACTCGGGCGGCAACACGCTGGCCTATTCGCTGCAGAGTCTTGCTCGCCTGCTCGAGCTG
GACATGGGCTGGGACATATTCAAGGGCGCCACGTCGACGGACCTTGTTGAGCGAGTGGTTGAGCTCATTGTCACC
AATCCCCTGGTTAACATCCTCCGTGGCGCAATGTCCATTCTCGTTGCCCTCGTCAGCCATTCCCAGTCGGATGCG
ACCGACGCCGTCTTTGGCTTCCGCGGCCTCAAGCCCGCCGTTGCCGTCTTTCCTCAGTTTTTCGAGCTCGTCATC
CAGCAGCTCGACAGTGCCGACCACGCCCTGTGCGCAAACGCCCTCATGCTCATCAACGCTCTGCTGCGCGACGCC
CTGGGCGCATCGGCCAGTGCCACCGACGGCGCCTGGAGCAGCGGCACCACGGGCGACGACTGGGCCAAGTTTGTC
AAGCGCTTGCAGGACTTGGGCCTGGTGCAGGCTGTCTATAGGCTCATGCAGAGCTCTTCCATCCAGGACCTGGTG
CATCCGCTGCTCGAGTTCCAGTCGCTGAGCAAAAGCGTCATAGCCAAATGGCGCCACGTCAGAGTCGACCTTGGC
GATGCCCAACACCGGCGCTTGCTCAAGAGCATCCACGCCGCGAGCGCCCCCGAAGCCAACGGCAGCTTGGAGCAA
TGGCAGACGCAGGCGGCCCAAGAGCACCAAGGCCAGCACAAGGCTGAGAAATGGAGCCGGCTGGGCTTCTCGAGC
GAGAGCCCGGGCCAAGACTTTGAACAGACGGGCTTCCTGGGCATGATGGACTTGAGCGACTATGCCGGCAGACAC
GAGGATGCCTTTCAAAAGCTGCTGCTCGAGCAGGCCGCCAAGCCCGTGGCCCAACGCTGTCCCGTTGCCCGCGCC
AGCCTGGCCGTGACGGCGATTCTTTACCAAGACTTTGACATGGACAAGGCCGACGTCGACGATGCCAAGGCCCAT
GACAGCACCGACGCCAAGGAGCACGACTCGCTCTTCCGGCCGCTCTTGCTGCAGTGGTCACGGCTGCACACGGCT
GGCCTGCAGGCCTTTGTCCGCATATGGAAGTCGACGGGCGCCGAGCAAGACGACTTTGAAAAGGTGGCTGAACTG
ACGCGCATCCTGGTTGAGCAGGTGGTGGGCCAGGCCAGCCGCACCAGAAGCATTGCCCAGGTCGAGGACGAGATG
CTCGAGTACGAGACTGCGCGCCTGCGCCAAGTGCAGATGGAGCTGCTGGAGCGTGCCTTTGAGGCCACTTGGGGC
CGGCACCTGGATCAGGCCCGGCAGGTGCTCAAGCACGAGGCGCTGCAGTTTGTCAAGGAGCAGCGAGTGCGCTGC
CTGCTGCAAGGAGCCTGGTTCACCAAGCCCACAGCCGCCGGCCAGGAGCGCTGGAGATATGCCAAGCTGTCGCAC
AATCGGCGCTTCCTGCACTACGCCGACTTTGAAGGCCGCATGGCCCAAGATCCCGGCCTCGACAGCCTGGCAGAC
AAGGTGGACCTGAGCAGCATAAGCTCCGTCGTGTCCAACGTGTCTGCCCCCAGCGACGAGGCGACGGCGCAGCAG
GGCGCAGCAACGACCAAGATCACCGTGTACAGCCTGGCCCAGCCAGAGGCCCAGCCAGAGGCCCAGCAAGAGGCC
CAGCAAGAGGCCCAGCAAGAGGCCCATGAAGAGGCCCTTCTGACGCTCTGGCCTACAAGCCCCAGCCTGGCATCC
GAGTGGCTCGATGGGCTGCTGATGCTGCTCAACCAAGCACCCATAACAGCCGAGACGAGCAAGCTCATTCATCTC
ATTAGCGACTATGGCTTGAAGATTCGACTGCTCAATGTGCGTCTGGATACAGCGTTTGAAGGGCCATCGCCAGAG
GCAGGCGTGGTGCCGAGTCGCGAGGGGCTTGATAGCGACTATTACTTTGACGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail