Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7636
Gene name
LocationContig_84:14612..15512
Strand+
Gene length (bp)900
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09769 ApoO Apolipoprotein O 2.7E-40 86 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P50087|MIC26_YEAST MICOS subunit MIC26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC26 PE=1 SV=1 112 255 4.0E-13

GO

GO Term Description Terminal node
GO:0061617 MICOS complex Yes
GO:0042407 cristae formation Yes
GO:0032991 protein-containing complex No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0007007 inner mitochondrial membrane organization No
GO:0016043 cellular component organization No
GO:0007005 mitochondrion organization No
GO:0007006 mitochondrial membrane organization No
GO:0005575 cellular_component No
GO:0098796 membrane protein complex No
GO:0061024 membrane organization No
GO:0098798 mitochondrial protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 149 166 17
3 171 193 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7636
MAARVLLQRRSVALLAVGGLALYPTSVIAEAPAHQRKPIYDDFDTLSARSVAPPSAPKQAPEAQQVAPSASSNSK
TDVDAALAPQPSRGPTPTDRLAVQIGRVRLFLHDCAAAAEDRVNGAMDAAFNMEHSFTTTIASLAPPRESGEKLM
PGVIYVLVAAMAGSVVTRNRGFLLRTTVPLAFGVGAGWLLLPITMRNVANLSWSYEKHFPAIADAHLRLREGIDQ
SLSFAKTRSQAGKRYVDEKVTDAREAVEGWVKQGK*
Coding >OphauB2|7636
ATGGCTGCCCGAGTGCTTCTTCAACGGCGCTCCGTCGCCCTTCTGGCCGTCGGAGGCCTGGCCCTATACCCAACC
AGCGTCATAGCCGAAGCTCCGGCCCATCAGAGGAAACCAATCTATGATGACTTTGACACCTTGTCGGCGCGCTCC
GTTGCTCCTCCGTCTGCGCCAAAGCAGGCTCCCGAGGCGCAGCAAGTCGCACCCTCCGCCAGCAGCAATTCCAAG
ACGGACGTCGACGCCGCCCTGGCACCTCAGCCCTCCCGGGGCCCTACTCCGACGGACCGGCTAGCCGTGCAGATT
GGCAGGGTCCGACTCTTCCTACACGACTGTGCCGCCGCGGCAGAGGATCGCGTCAATGGCGCCATGGACGCCGCC
TTCAATATGGAGCACTCCTTCACCACCACCATTGCCTCGCTTGCACCTCCCCGTGAGAGCGGCGAGAAGCTCATG
CCTGGCGTCATCTACGTTCTCGTCGCTGCCATGGCGGGCTCTGTCGTGACGCGCAACCGCGGCTTCCTTCTTCGC
ACCACTGTCCCTCTCGCCTTTGGCGTCGGTGCTGGCTGGCTTCTTTTGCCCATTACGATGCGCAATGTCGCCAAT
CTGTCCTGGTCCTACGAAAAGCACTTCCCTGCCATTGCTGATGCCCACCTGCGCTTGCGTGAGGGCATTGACCAG
AGCCTAAGCTTTGCAAAGACTCGCTCTCAGGCGGGAAAGCGCTACGTTGATGAAAAAGTGACGGATGCGCGCGAG
GCTGTCGAGGGATGGGTCAAGCAGGGAAAATAG
Transcript >OphauB2|7636
ATGGCTGCCCGAGTGCTTCTTCAACGGCGCTCCGTCGCCCTTCTGGCCGTCGGAGGCCTGGCCCTATACCCAACC
AGCGTCATAGCCGAAGCTCCGGCCCATCAGAGGAAACCAATCTATGATGACTTTGACACCTTGTCGGCGCGCTCC
GTTGCTCCTCCGTCTGCGCCAAAGCAGGCTCCCGAGGCGCAGCAAGTCGCACCCTCCGCCAGCAGCAATTCCAAG
ACGGACGTCGACGCCGCCCTGGCACCTCAGCCCTCCCGGGGCCCTACTCCGACGGACCGGCTAGCCGTGCAGATT
GGCAGGGTCCGACTCTTCCTACACGACTGTGCCGCCGCGGCAGAGGATCGCGTCAATGGCGCCATGGACGCCGCC
TTCAATATGGAGCACTCCTTCACCACCACCATTGCCTCGCTTGCACCTCCCCGTGAGAGCGGCGAGAAGCTCATG
CCTGGCGTCATCTACGTTCTCGTCGCTGCCATGGCGGGCTCTGTCGTGACGCGCAACCGCGGCTTCCTTCTTCGC
ACCACTGTCCCTCTCGCCTTTGGCGTCGGTGCTGGCTGGCTTCTTTTGCCCATTACGATGCGCAATGTCGCCAAT
CTGTCCTGGTCCTACGAAAAGCACTTCCCTGCCATTGCTGATGCCCACCTGCGCTTGCGTGAGGGCATTGACCAG
AGCCTAAGCTTTGCAAAGACTCGCTCTCAGGCGGGAAAGCGCTACGTTGATGAAAAAGTGACGGATGCGCGCGAG
GCTGTCGAGGGATGGGTCAAGCAGGGAAAATAG
Gene >OphauB2|7636
ATGGCTGCCCGAGTGCTTCTTCAACGGGTGAGAAGCTTCATCAACGCTCCCCTCGCTACTTGCTTGCCATCTGCT
GACCGTCTCCCGCAGCGCTCCGTCGCCCTTCTGGCCGTCGGAGGCCTGGCCCTATACCCAACCAGCGTCATAGCC
GAAGCTCCGGCCCATCAGGTGCGTTCATGTCTCGAGACCAGCACAGCAGCGGCTCATGCCATGCGCCATTAGAGG
AAACCAATCTATGATGACTTTGACACCTTGTCGGCGCGCTCCGTTGCTCCTCCGTCTGCGCCAAAGCAGGCTCCC
GAGGCGCAGCAAGTCGCACCCTCCGCCAGCAGCAATTCCAAGACGGACGTCGACGCCGCCCTGGCACCTCAGCCC
TCCCGGGGCCCTACTCCGACGGACCGGCTAGCCGTGCAGATTGGCAGGGTCCGACTCTTCCTACACGACTGTGCC
GCCGCGGCAGAGGATCGCGTCAATGGCGCCATGGACGCCGCCTTCAATATGGAGCACTCCTTCACCACCACCATT
GCCTCGCTTGCACCTCCCCGTGAGAGCGGCGAGAAGCTCATGCCTGGCGTCATCTACGTTCTCGTCGCTGCCATG
GCGGGCTCTGTCGTGACGCGCAACCGCGGCTTCCTTCTTCGCACCACTGTCCCTCTCGCCTTTGGCGTCGGTGCT
GGCTGGCTTCTTTTGCCCATTACGATGCGCAATGTCGCCAATCTGTCCTGGTCCTACGAAAAGCACTTCCCTGCC
ATTGCTGATGCCCACCTGCGCTTGCGTGAGGGCATTGACCAGAGCCTAAGCTTTGCAAAGACTCGCTCTCAGGCG
GGAAAGCGCTACGTTGATGAAAAAGTGACGGATGCGCGCGAGGCTGTCGAGGGATGGGTCAAGCAGGGAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail