Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7633
Gene name
LocationContig_84:5163..7052
Strand+
Gene length (bp)1889
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13086 AAA_11 AAA domain 1.4E-59 51 266
PF13087 AAA_12 AAA domain 1.2E-55 300 510
PF13604 AAA_30 AAA domain 3.2E-11 51 262
PF13245 AAA_19 AAA domain 2.3E-08 56 262
PF04851 ResIII Type III restriction enzyme, res subunit 3.1E-05 52 233
PF00580 UvrD-helicase UvrD/REP helicase N-terminal domain 6.2E-06 52 247
PF09848 DUF2075 Schlafen group 3, DNA/RNA helicase domain 7.4E-05 68 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 1 531 1.0E-163
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 1 538 9.0E-129
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 17 534 4.0E-127
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 8 534 2.0E-126
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 8 534 1.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 1 531 1.0E-163
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 1 538 9.0E-129
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 17 534 4.0E-127
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 8 534 2.0E-126
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 8 534 1.0E-125
sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 8 534 8.0E-125
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 19 530 2.0E-73
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 52 515 3.0E-56
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 52 530 6.0E-56
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 29 527 2.0E-55
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 52 527 2.0E-54
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 52 515 4.0E-53
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 52 515 6.0E-53
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 50 528 4.0E-50
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 52 515 7.0E-49
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 52 515 4.0E-45
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 52 515 7.0E-45
sp|Q8QHA5|DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis GN=dna2 PE=1 SV=1 52 515 2.0E-43
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 49 530 6.0E-42
sp|P51530|DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens GN=DNA2 PE=1 SV=3 26 508 5.0E-41
sp|E1BMP7|DNA2_BOVIN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus GN=DNA2 PE=3 SV=3 26 515 1.0E-40
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 52 529 4.0E-40
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 43 540 2.0E-39
sp|D3ZG52|DNA2_RAT DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus GN=Dna2 PE=3 SV=1 52 515 3.0E-39
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 52 529 5.0E-39
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 52 513 6.0E-39
sp|Q6ZQJ5|DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus GN=Dna2 PE=1 SV=2 52 515 4.0E-37
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 52 519 9.0E-37
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 97 513 2.0E-36
sp|Q5ZKG3|DNA2_CHICK DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus GN=DNA2 PE=2 SV=2 52 515 3.0E-36
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 96 514 5.0E-35
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 52 532 5.0E-34
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 52 545 9.0E-34
sp|Q9URU2|DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dna2 PE=1 SV=2 10 528 5.0E-32
sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=2 SV=1 44 519 1.0E-30
sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 48 521 3.0E-30
sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 37 519 3.0E-29
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 22 533 3.0E-28
sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 46 534 2.0E-27
sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 71 528 3.0E-26
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 55 508 3.0E-26
sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 71 528 4.0E-26
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 69 509 3.0E-25
sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=1 SV=4 44 509 2.0E-24
sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 31 528 3.0E-24
sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 71 526 2.0E-22
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 157 515 1.0E-19
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 157 515 3.0E-19
sp|P42694|HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens GN=HELZ PE=1 SV=2 28 534 4.0E-19
sp|F6QXW0|DNA2_XENTR DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus tropicalis GN=dna2 PE=3 SV=1 299 515 4.0E-19
sp|Q6DFV5|HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus GN=Helz PE=1 SV=2 28 534 5.0E-19
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain OS=Danio rerio GN=helz PE=2 SV=1 28 527 1.0E-18
sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 71 509 2.0E-17
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 184 517 8.0E-14
sp|Q09449|YQ12_CAEEL Uncharacterized ATP-dependent helicase C05C10.2 OS=Caenorhabditis elegans GN=C05C10.2 PE=3 SV=1 228 519 9.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0004386 helicase activity Yes
GO:0003677 DNA binding Yes
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2823
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5330
Ophiocordyceps australis map64 (Brazil) OphauB2|7633 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00435
Ophiocordyceps camponoti-rufipedis Ophun1|7038
Ophiocordyceps kimflemingae Ophio5|7656
Ophiocordyceps subramaniannii Hirsu2|4571

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7633
MNLTMEKLQKMDPCQYSALIRVLFGLSTPSPVAPDLSRDEQFGKIQWIDATLNDSQKDAIRFALASREIALIHGP
PGTGKTHTLIELILQLVKRGQRILVCGPSNISVDNIVERLAPHKVAMLRLGHPARLLPSVVSHSLDVLTQTSEAG
AIVKDVRAEMDLKQASIKKTKSGKERRAIYADLKELRKEYRLREKNCVSSLVRGTSVVLATLHGAGGAQLRSEAF
DLVIIDEASQALEAQCWVPLLAAKKVVCAGDHLQLPPTIKSTNSKLKSQGKETKSKETKSKESQELPVKGTTSLA
TTLFDRLLALHGPSIKRMLTTQYRMHDKIMRFPSNELYDAKLIAAEAVKQRLLRDLDYPVDDTENTTEPLIFIDT
QGGDFAERNDNEKDDADSVSKTKASLHGDSKSNEMEASLVKQHVKHLVDAGVHAEDIAVVTPYNAQLALLAPLKE
QFPGIELGSVDGFQGREKEAVIVSLVRSNAEGDVGFLGEKRRLNVAMTRPKRSLVVIGDSETVSRGSTFLKRWMG
FLEDQADLRYPDLSAVSRES*
Coding >OphauB2|7633
ATGAACCTCACCATGGAGAAGCTGCAGAAAATGGACCCTTGTCAGTACTCTGCCTTGATCAGGGTTCTATTTGGC
CTCTCCACCCCCTCTCCCGTTGCGCCCGACCTGAGCCGCGATGAGCAGTTTGGAAAAATCCAGTGGATAGATGCT
ACACTCAACGACTCCCAAAAGGACGCGATTCGCTTCGCCCTCGCCTCTCGCGAAATTGCCTTGATTCACGGACCT
CCAGGAACCGGCAAAACTCACACCCTCATCGAGCTTATTCTACAACTGGTAAAGCGCGGTCAGAGAATCTTGGTG
TGCGGTCCGTCAAACATATCTGTTGACAATATTGTCGAGCGCCTGGCGCCCCATAAAGTAGCCATGTTGCGCCTC
GGCCATCCGGCTCGTCTCCTCCCGTCAGTCGTCAGCCACTCTCTCGACGTACTGACACAGACGTCAGAGGCTGGT
GCCATAGTCAAAGACGTGCGCGCTGAGATGGACTTGAAGCAAGCTTCGATAAAGAAGACCAAGAGCGGAAAGGAA
CGGAGAGCAATCTACGCCGACCTCAAGGAACTGAGAAAAGAGTACCGCCTTCGGGAAAAAAACTGTGTCAGCAGC
CTGGTGCGAGGAACGAGCGTTGTTCTCGCCACTCTTCATGGCGCCGGCGGAGCTCAGTTGCGCAGTGAAGCATTC
GACCTTGTCATTATCGACGAGGCTAGCCAAGCCCTCGAGGCTCAATGCTGGGTGCCTCTGCTAGCAGCAAAAAAA
GTTGTGTGTGCCGGTGATCATCTCCAACTGCCACCAACCATCAAGTCGACCAATTCCAAGCTCAAGTCGCAGGGC
AAAGAGACGAAGAGCAAAGAGACGAAGAGCAAAGAGTCGCAGGAGCTACCCGTAAAGGGCACTACTAGTCTTGCC
ACGACGCTCTTTGACCGTCTCTTGGCTCTTCACGGGCCCTCAATCAAGCGCATGCTGACAACCCAGTATCGCATG
CATGACAAAATCATGCGTTTCCCCTCTAATGAGCTGTACGATGCAAAGCTCATTGCTGCCGAAGCTGTCAAGCAA
CGTCTACTGCGGGACTTGGATTACCCTGTCGACGACACTGAGAACACCACGGAACCCCTCATCTTTATTGATACG
CAGGGCGGCGACTTTGCCGAGAGGAACGACAATGAAAAGGATGACGCTGACAGCGTCAGCAAGACCAAGGCAAGC
TTACACGGCGACAGCAAAAGCAATGAAATGGAGGCATCTCTAGTGAAGCAGCATGTCAAGCACCTGGTTGATGCC
GGAGTGCATGCAGAAGATATTGCCGTTGTGACTCCCTACAATGCTCAGCTGGCCCTGCTGGCACCGCTCAAGGAG
CAATTTCCTGGCATAGAGCTCGGAAGCGTCGACGGCTTCCAGGGCCGCGAAAAGGAAGCTGTCATTGTCAGCCTT
GTGCGGAGCAATGCCGAGGGAGATGTTGGCTTCTTGGGCGAGAAGCGGCGGTTGAATGTTGCCATGACACGCCCC
AAACGATCACTAGTTGTCATTGGCGACTCAGAAACGGTGAGCAGGGGCAGTACTTTCCTCAAGCGATGGATGGGG
TTTCTAGAAGACCAGGCTGATCTGCGATACCCCGACCTCTCAGCCGTGAGCCGAGAGAGTTAG
Transcript >OphauB2|7633
ATGAACCTCACCATGGAGAAGCTGCAGAAAATGGACCCTTGTCAGTACTCTGCCTTGATCAGGGTTCTATTTGGC
CTCTCCACCCCCTCTCCCGTTGCGCCCGACCTGAGCCGCGATGAGCAGTTTGGAAAAATCCAGTGGATAGATGCT
ACACTCAACGACTCCCAAAAGGACGCGATTCGCTTCGCCCTCGCCTCTCGCGAAATTGCCTTGATTCACGGACCT
CCAGGAACCGGCAAAACTCACACCCTCATCGAGCTTATTCTACAACTGGTAAAGCGCGGTCAGAGAATCTTGGTG
TGCGGTCCGTCAAACATATCTGTTGACAATATTGTCGAGCGCCTGGCGCCCCATAAAGTAGCCATGTTGCGCCTC
GGCCATCCGGCTCGTCTCCTCCCGTCAGTCGTCAGCCACTCTCTCGACGTACTGACACAGACGTCAGAGGCTGGT
GCCATAGTCAAAGACGTGCGCGCTGAGATGGACTTGAAGCAAGCTTCGATAAAGAAGACCAAGAGCGGAAAGGAA
CGGAGAGCAATCTACGCCGACCTCAAGGAACTGAGAAAAGAGTACCGCCTTCGGGAAAAAAACTGTGTCAGCAGC
CTGGTGCGAGGAACGAGCGTTGTTCTCGCCACTCTTCATGGCGCCGGCGGAGCTCAGTTGCGCAGTGAAGCATTC
GACCTTGTCATTATCGACGAGGCTAGCCAAGCCCTCGAGGCTCAATGCTGGGTGCCTCTGCTAGCAGCAAAAAAA
GTTGTGTGTGCCGGTGATCATCTCCAACTGCCACCAACCATCAAGTCGACCAATTCCAAGCTCAAGTCGCAGGGC
AAAGAGACGAAGAGCAAAGAGACGAAGAGCAAAGAGTCGCAGGAGCTACCCGTAAAGGGCACTACTAGTCTTGCC
ACGACGCTCTTTGACCGTCTCTTGGCTCTTCACGGGCCCTCAATCAAGCGCATGCTGACAACCCAGTATCGCATG
CATGACAAAATCATGCGTTTCCCCTCTAATGAGCTGTACGATGCAAAGCTCATTGCTGCCGAAGCTGTCAAGCAA
CGTCTACTGCGGGACTTGGATTACCCTGTCGACGACACTGAGAACACCACGGAACCCCTCATCTTTATTGATACG
CAGGGCGGCGACTTTGCCGAGAGGAACGACAATGAAAAGGATGACGCTGACAGCGTCAGCAAGACCAAGGCAAGC
TTACACGGCGACAGCAAAAGCAATGAAATGGAGGCATCTCTAGTGAAGCAGCATGTCAAGCACCTGGTTGATGCC
GGAGTGCATGCAGAAGATATTGCCGTTGTGACTCCCTACAATGCTCAGCTGGCCCTGCTGGCACCGCTCAAGGAG
CAATTTCCTGGCATAGAGCTCGGAAGCGTCGACGGCTTCCAGGGCCGCGAAAAGGAAGCTGTCATTGTCAGCCTT
GTGCGGAGCAATGCCGAGGGAGATGTTGGCTTCTTGGGCGAGAAGCGGCGGTTGAATGTTGCCATGACACGCCCC
AAACGATCACTAGTTGTCATTGGCGACTCAGAAACGGTGAGCAGGGGCAGTACTTTCCTCAAGCGATGGATGGGG
TTTCTAGAAGACCAGGCTGATCTGCGATACCCCGACCTCTCAGCCGTGAGCCGAGAGAGTTAG
Gene >OphauB2|7633
ATGAACCTCACCATGGAGAAGCTGCAGAAAATGGACCCTTGTCAGTACTCTGCCTTGATCAGGGTTCTATTTGGC
CTCTCCACCCCCTCTCCCGTTGCGCCCGACCTGAGCCGCGATGAGCAGTTTGGAAAAATCCAGTGGATAGATGCT
ACACTCAACGACTCCCAAAAGGACGCGATTCGCTTCGCCCTCGCCTCTCGCGAAATTGCCTTGATTCACGGACCT
CCAGGAGTGTGTGCCTCACCACCACAGGTGGCCAACCGCCGCTGACGTTGCCCTCTCCTAGACCGGCAAAACTCA
CACCCTCATCGAGCTTATTCTACAACTGGTAAAGCGCGGTCAGAGAATCTTGGTGTGCGGTCCGTCAAACATATC
TGTTGACAATATTGTCGAGCGCCTGGCGCCCCATAAAGTAGCCATGTTGCGCCTCGGCCATCCGGCTCGTCTCCT
CCCGTCAGTCGTCAGCCACTCTCTCGACGTACTGACACAGACGTCAGAGGCTGGTGCCATAGTCAAAGACGTGCG
CGCTGAGATGGACTTGAAGCAAGCTTCGATAAAGAAGACCAAGAGCGGAAAGGAACGGAGAGCAATCTACGCCGA
CCTCAAGGAACTGAGAAAAGAGTACCGCCTTCGGGAAAAAAACTGTGTCAGCAGCCTGGTGCGAGGAACGAGCGT
TGTTCTCGCCACTCTTCATGGCGCCGGCGGAGCTCAGTTGCGCAGTGAAGCATTCGACCTTGTCATTATCGACGA
GGCTAGCCAAGCCCTCGAGGCTCAATGCTGGGTGCCTCTGCTAGCAGCAAAAAAAGTTGTGTGTGCCGGTGATCA
TCTCCAACTGCCACCAACCATCAAGTCGACCAATTCCAAGCTCAAGTCGCAGGGCAAAGAGACGAAGAGCAAAGA
GACGAAGAGCAAAGAGTCGCAGGAGCTACCCGTAAAGGGCACTACTAGTCTTGCCACGACGCTCTTTGACCGTCT
CTTGGCTCTTCACGGGCCCTCAATCAAGCGCATGCTGACAACCCAGTATCGCATGCATGACAAAATCATGCGTTT
CCCCTCTAATGAGCTGTACGATGCAAAGCTCATTGCTGCCGAAGCTGTCAAGCAACGTCTACTGCGGGACTTGGA
TTACCCTGTCGACGACACTGAGAACACCACGGAACCCCTCATCTTTATTGATACGCAGGGCGGCGACTTTGCCGA
GAGGAACGACAATGAAAAGGATGACGCTGACAGCGTCAGCAAGACCAAGGCAAGCTTACACGGCGACAGCAAAAG
CAATGAAATGGAGGCATCTCTAGTGAAGCAGCATGTCAAGCACCTGGTTGATGCCGGAGTGCATGCAGAAGATAT
TGCCGTTGTGACTCCCTACAATGCTCAGGTAGTGTATTGCAAGCCGAGTCTCGCAACGGACTCTTGTGCTGACCC
AACTTGCCCGTCATAGCTGGCCCTGCTGGCACCGCTCAAGGAGCAATTTCCTGGCATAGAGCTCGGAAGCGTCGA
CGGCTTCCAGGGCCGCGAAAAGGAAGCTGTCATTGTCAGCCTTGTGCGGAGCAATGCCGAGGGAGATGTTGGCTT
CTTGGGCGAGAAGCGGCGGTTGAATGGTTAGTCATTGTTGTGCCATGTTTTGAGACTAGTAGTTGTTTATTGTTT
AACGACAAACTAGTTGCCATGACACGCCCCAAACGATCACTAGTTGTCATTGGCGACTCAGAAACGGTGAGCAGG
TAAAGGAAAAGCGCCCGTATAGACTTGCCCGTCACCAGGCTAACGCGTTGCATTCATCGTGGGTTGGCAGGGGCA
GTACTTTCCTCAAGCGATGGATGGGGTTTCTAGAAGACCAGGCTGATCTGCGATACCCCGACCTCTCAGCCGTGA
GCCGAGAGAGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail