Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7631
Gene name
LocationContig_84:3092..4149
Strand+
Gene length (bp)1057
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02656 DUF202 Domain of unknown function (DUF202) 1.3E-20 190 267

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 200 222 22
2 242 260 18
3 281 303 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7631
MAKSMHPQHDAPTPTRTVSFSNVAHQRRQSTSERISEILETGRNRAESMPSPDSVSRSRRLSDPSDDDERTSIMS
RGSGQNYMAMQERPTPQSIYRRLSVTQQQPQQEPQQQQQEQQQHQHQHQQQQQLHQQLHQQLQQHLQLQLQQQQQ
QQQQLPQDNGQLASPSRSWWRKLLGNFQSVELDNKGSVARDHLALERTFLAWLRTSLAFASIGIAVTQLFRLNMS
LSDTDTLDQSALRRLGRPLGACFLAISILTLGLGFRRYFNGQQWILRGKFPASRGTIIVVGLMALAIMFVSLIVV
VVIHPTDEERDRGL*
Coding >OphauB2|7631
ATGGCCAAGAGCATGCATCCACAGCATGATGCGCCAACTCCCACCCGCACCGTGTCCTTTTCCAATGTCGCTCAC
CAGCGGCGCCAGTCTACATCGGAGCGCATCAGCGAGATTCTCGAGACGGGCCGCAACCGAGCCGAGAGCATGCCC
TCGCCTGACTCTGTATCGCGAAGCCGCCGCTTGTCGGATCCCAGCGACGATGATGAGAGGACGAGCATCATGTCG
CGCGGCTCCGGCCAGAACTATATGGCTATGCAGGAGCGCCCGACACCACAGTCGATATACCGCAGGCTGTCTGTG
ACGCAGCAGCAGCCACAGCAGGAACCGCAACAGCAGCAACAAGAGCAGCAGCAGCATCAGCATCAGCATCAGCAA
CAACAACAACTGCACCAACAACTGCACCAACAACTGCAACAACATCTGCAACTGCAACTGCAACAACAACAACAA
CAACAACAACAACTGCCACAAGACAATGGACAACTTGCCTCCCCCTCACGGTCGTGGTGGAGAAAACTCTTGGGC
AACTTTCAGTCCGTCGAGCTCGACAACAAGGGCAGTGTGGCCCGAGACCATCTAGCACTAGAGCGCACTTTTCTC
GCCTGGCTGCGCACCTCGCTGGCATTTGCCTCGATTGGCATTGCCGTCACGCAGCTGTTTCGCCTCAACATGTCG
CTCTCGGATACCGACACGCTGGACCAGAGCGCCCTGCGGCGGCTGGGCCGCCCCCTGGGAGCTTGCTTTCTCGCC
ATTAGCATCCTGACGCTGGGGCTGGGCTTCCGGCGCTACTTCAACGGCCAGCAATGGATTCTTCGCGGCAAGTTT
CCCGCCAGCCGCGGCACCATTATTGTCGTTGGGTTGATGGCGCTGGCCATTATGTTCGTGTCGCTCATTGTCGTT
GTGGTTATTCACCCGACTGATGAGGAGCGAGACAGAGGTTTGTGA
Transcript >OphauB2|7631
ATGGCCAAGAGCATGCATCCACAGCATGATGCGCCAACTCCCACCCGCACCGTGTCCTTTTCCAATGTCGCTCAC
CAGCGGCGCCAGTCTACATCGGAGCGCATCAGCGAGATTCTCGAGACGGGCCGCAACCGAGCCGAGAGCATGCCC
TCGCCTGACTCTGTATCGCGAAGCCGCCGCTTGTCGGATCCCAGCGACGATGATGAGAGGACGAGCATCATGTCG
CGCGGCTCCGGCCAGAACTATATGGCTATGCAGGAGCGCCCGACACCACAGTCGATATACCGCAGGCTGTCTGTG
ACGCAGCAGCAGCCACAGCAGGAACCGCAACAGCAGCAACAAGAGCAGCAGCAGCATCAGCATCAGCATCAGCAA
CAACAACAACTGCACCAACAACTGCACCAACAACTGCAACAACATCTGCAACTGCAACTGCAACAACAACAACAA
CAACAACAACAACTGCCACAAGACAATGGACAACTTGCCTCCCCCTCACGGTCGTGGTGGAGAAAACTCTTGGGC
AACTTTCAGTCCGTCGAGCTCGACAACAAGGGCAGTGTGGCCCGAGACCATCTAGCACTAGAGCGCACTTTTCTC
GCCTGGCTGCGCACCTCGCTGGCATTTGCCTCGATTGGCATTGCCGTCACGCAGCTGTTTCGCCTCAACATGTCG
CTCTCGGATACCGACACGCTGGACCAGAGCGCCCTGCGGCGGCTGGGCCGCCCCCTGGGAGCTTGCTTTCTCGCC
ATTAGCATCCTGACGCTGGGGCTGGGCTTCCGGCGCTACTTCAACGGCCAGCAATGGATTCTTCGCGGCAAGTTT
CCCGCCAGCCGCGGCACCATTATTGTCGTTGGGTTGATGGCGCTGGCCATTATGTTCGTGTCGCTCATTGTCGTT
GTGGTTATTCACCCGACTGATGAGGAGCGAGACAGAGGTTTGTGA
Gene >OphauB2|7631
ATGGCCAAGAGCATGCATCCACAGCATGATGCGCCAACTCCCACCCGCACCGTGTCCTTTTCCAATGTCGCTCAC
CAGCGGCGCCAGTCTACATCGGAGCGCATCAGCGAGATTCTCGAGGTGCAGCCCAGTCCACCCTGCCCTCGGGCG
CGCGCTGACCGCCGCTGACTGCAAGACAGACGGGCCGCAACCGAGCCGAGAGCATGCCCTCGCCTGACTCTGTAT
CGCGAAGCCGCCGCTTGTCGGATCCCAGCGACGATGATGAGAGGACGAGCATCATGTCGCGCGGCTCCGGCCAGA
ACTATATGGCTATGCAGGAGCGCCCGACACCACAGTCGATATACCGCAGGCTGTCTGTGACGCAGCAGCAGCCAC
AGCAGGAACCGCAACAGCAGCAACAAGAGCAGCAGCAGCATCAGCATCAGCATCAGCAACAACAACAACTGCACC
AACAACTGCACCAACAACTGCAACAACATCTGCAACTGCAACTGCAACAACAACAACAACAACAACAACAACTGC
CACAAGACAATGGACAACTTGCCTCCCCCTCACGGTCGTGGTGGAGAAAACTCTTGGGCAACTTTCAGTCCGTCG
AGCTCGACAACAAGGGCAGTGTGGCCCGAGACCATCTAGCACTAGGTATGTCGCGGCGCAGCCTGTGCCAGCCAG
CATCAAGACTCACAGCCTTGTAGAGCGCACTTTTCTCGCCTGGCTGCGCACCTCGCTGGCATTTGCCTCGATTGG
CATTGCCGTCACGCAGCTGTTTCGCCTCAACATGTCGCTCTCGGATACCGACACGCTGGACCAGAGCGCCCTGCG
GCGGCTGGGCCGCCCCCTGGGAGCTTGCTTTCTCGCCATTAGCATCCTGACGCTGGGGCTGGGCTTCCGGCGCTA
CTTCAACGGCCAGCAATGGATTCTTCGCGGCAAGTTTCCCGCCAGCCGCGGCACCATTATTGTCGTTGGGTTGAT
GGCGCTGGCCATTATGTTCGTGTCGCTCATTGTCGTTGTGGTTATTCACCCGACTGATGAGGAGCGAGACAGAGG
TTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail