Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7628
Gene name
LocationContig_83:72297..74034
Strand+
Gene length (bp)1737
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 6.6E-80 157 518
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 3.1E-07 55 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 38 524 1.0E-102
sp|P25345|SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 55 517 9.0E-102
sp|P58692|SYN_NOSS1 Asparagine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=asnS PE=3 SV=1 57 517 9.0E-100
sp|Q9P6I0|SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm5 PE=3 SV=1 55 520 1.0E-98
sp|Q73P19|SYN_TREDE Asparagine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=asnS PE=3 SV=1 55 517 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 38 524 1.0E-102
sp|P25345|SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 55 517 9.0E-102
sp|P58692|SYN_NOSS1 Asparagine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=asnS PE=3 SV=1 57 517 9.0E-100
sp|Q9P6I0|SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm5 PE=3 SV=1 55 520 1.0E-98
sp|Q73P19|SYN_TREDE Asparagine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=asnS PE=3 SV=1 55 517 4.0E-98
sp|Q96I59|SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens GN=NARS2 PE=1 SV=3 20 522 2.0E-97
sp|Q8BGV0|SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus GN=Nars2 PE=1 SV=1 55 522 3.0E-97
sp|Q899M9|SYN_CLOTE Asparagine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=asnS PE=3 SV=1 54 523 3.0E-97
sp|B1XKH1|SYN_SYNP2 Asparagine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=asnS PE=3 SV=1 47 517 5.0E-97
sp|A5N4F7|SYN_CLOK5 Asparagine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=asnS PE=3 SV=1 54 523 7.0E-97
sp|Q317J6|SYN_DESAG Asparagine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=asnS PE=3 SV=1 37 517 3.0E-96
sp|Q55FI3|SYNM_DICDI Probable asparagine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=asnS2 PE=3 SV=1 40 522 6.0E-96
sp|A7GTK8|SYN_BACCN Asparagine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=asnS PE=3 SV=1 54 523 8.0E-96
sp|A0LL53|SYN_SYNFM Asparagine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=asnS PE=3 SV=1 35 523 1.0E-95
sp|A0PY64|SYN_CLONN Asparagine--tRNA ligase OS=Clostridium novyi (strain NT) GN=asnS PE=3 SV=1 55 520 3.0E-95
sp|Q817I8|SYN_BACCR Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=asnS PE=3 SV=1 55 523 9.0E-95
sp|A7GB01|SYN_CLOBL Asparagine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=asnS PE=3 SV=1 55 523 1.0E-94
sp|Q633N6|SYN_BACCZ Asparagine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=asnS PE=3 SV=1 55 523 2.0E-94
sp|Q81L32|SYN_BACAN Asparagine--tRNA ligase OS=Bacillus anthracis GN=asnS PE=3 SV=1 55 523 2.0E-94
sp|Q6HCW9|SYN_BACHK Asparagine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=asnS PE=3 SV=1 55 523 2.0E-94
sp|Q72ZI3|SYN_BACC1 Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=asnS PE=3 SV=1 55 523 2.0E-94
sp|A5HZE1|SYN_CLOBH Asparagine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=asnS PE=3 SV=1 55 523 3.0E-94
sp|A7FRK8|SYN_CLOB1 Asparagine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=asnS PE=3 SV=1 55 523 3.0E-94
sp|Q72G53|SYN_DESVH Asparagine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=asnS PE=3 SV=1 38 523 4.0E-94
sp|A8MJ91|SYN_ALKOO Asparagine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=asnS PE=3 SV=1 55 517 1.0E-93
sp|B0JN99|SYN_MICAN Asparagine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=asnS PE=3 SV=1 54 517 1.0E-93
sp|P58693|SYN_CLOPE Asparagine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=asnS PE=3 SV=1 40 523 1.0E-93
sp|Q0TMF3|SYN_CLOP1 Asparagine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=asnS PE=3 SV=1 40 523 1.0E-93
sp|Q0SQ51|SYN_CLOPS Asparagine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=asnS PE=3 SV=1 40 523 1.0E-93
sp|P52276|SYN_SYNY3 Asparagine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=asnS PE=3 SV=2 55 517 1.0E-93
sp|A3DBI2|SYN_CLOTH Asparagine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=asnS PE=3 SV=1 57 517 2.0E-93
sp|A1V9B8|SYN_DESVV Asparagine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=asnS PE=3 SV=1 38 523 3.0E-93
sp|Q023P9|SYN_SOLUE Asparagine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=asnS PE=3 SV=1 54 523 3.0E-93
sp|Q11Q97|SYN_CYTH3 Asparagine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=asnS PE=3 SV=1 55 517 6.0E-93
sp|Q24MK1|SYN_DESHY Asparagine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=asnS PE=3 SV=1 55 523 6.0E-93
sp|Q8PM16|SYN_XANAC Asparagine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=asnS PE=3 SV=1 53 523 2.0E-92
sp|Q0SP63|SYN_BORAP Asparagine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=asnS PE=3 SV=1 53 517 3.0E-92
sp|Q3BV23|SYN_XANC5 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=asnS PE=3 SV=1 53 523 3.0E-92
sp|A5G5R2|SYN_GEOUR Asparagine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=asnS PE=3 SV=1 59 517 3.0E-92
sp|Q8DG51|SYN_THEEB Asparagine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=asnS PE=3 SV=1 55 523 1.0E-91
sp|Q2P326|SYN_XANOM Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=asnS PE=3 SV=1 53 523 2.0E-91
sp|Q8PAC4|SYN_XANCP Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=asnS PE=3 SV=1 53 523 3.0E-91
sp|Q4UTA1|SYN_XANC8 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=asnS PE=3 SV=1 53 523 3.0E-91
sp|Q5H049|SYN_XANOR Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=asnS PE=3 SV=1 53 523 4.0E-91
sp|Q6MEC9|SYN_PARUW Asparagine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=asnS PE=3 SV=1 54 523 6.0E-91
sp|Q74E08|SYN_GEOSL Asparagine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=asnS PE=3 SV=1 54 517 1.0E-90
sp|Q662R1|SYN_BORBP Asparagine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=asnS PE=3 SV=1 53 517 2.0E-90
sp|O51128|SYN_BORBU Asparagine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=asnS PE=3 SV=2 53 517 2.0E-90
sp|A6LPI6|SYN_CLOB8 Asparagine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=asnS PE=3 SV=1 55 520 3.0E-90
sp|A5IE87|SYN_LEGPC Asparagine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=asnS PE=3 SV=1 54 523 3.0E-90
sp|Q5WUG0|SYN_LEGPL Asparagine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=asnS PE=3 SV=1 54 523 4.0E-90
sp|Q3IGU4|SYN_PSEHT Asparagine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1 40 520 1.0E-89
sp|Q5X300|SYN_LEGPA Asparagine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=asnS PE=3 SV=1 54 523 1.0E-89
sp|Q8RH70|SYN_FUSNN Asparagine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=asnS PE=3 SV=1 37 517 1.0E-89
sp|A6TVS9|SYN_ALKMQ Asparagine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=asnS PE=3 SV=1 54 517 3.0E-89
sp|B2UXS0|SYN_CLOBA Asparagine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=asnS PE=3 SV=1 55 523 5.0E-89
sp|Q2SJV9|SYN_HAHCH Asparagine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=asnS PE=3 SV=1 40 517 6.0E-89
sp|B2TI01|SYN_CLOBB Asparagine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=asnS PE=3 SV=1 55 523 7.0E-89
sp|A6LIA1|SYN_PARD8 Asparagine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=asnS PE=3 SV=1 53 517 1.0E-88
sp|Q6D453|SYN_PECAS Asparagine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=asnS PE=3 SV=1 36 517 1.0E-88
sp|Q1DA04|SYN_MYXXD Asparagine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=asnS PE=3 SV=1 54 520 2.0E-88
sp|Q97E56|SYN_CLOAB Asparagine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=asnS PE=3 SV=1 55 523 2.0E-88
sp|Q8EW03|SYN_MYCPE Asparagine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=asnS PE=3 SV=1 37 523 5.0E-88
sp|A6WMP4|SYN_SHEB8 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=asnS PE=3 SV=1 53 517 8.0E-88
sp|A3D3V7|SYN_SHEB5 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=asnS PE=3 SV=1 53 517 1.0E-87
sp|Q8EEZ1|SYN_SHEON Asparagine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=asnS PE=3 SV=1 53 517 1.0E-87
sp|Q7UHE1|SYN_RHOBA Asparagine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=asnS PE=3 SV=1 10 523 1.0E-87
sp|P75521|SYN_MYCPN Asparagine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=asnS PE=3 SV=1 36 523 1.0E-87
sp|A1APP8|SYN_PELPD Asparagine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=asnS PE=3 SV=1 57 517 2.0E-87
sp|Q87NH5|SYN_VIBPA Asparagine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=asnS PE=3 SV=1 40 517 2.0E-87
sp|A8FVU8|SYN_SHESH Asparagine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=asnS PE=3 SV=1 53 517 2.0E-87
sp|A9KZ30|SYN_SHEB9 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=asnS PE=3 SV=1 53 517 4.0E-87
sp|Q39SY7|SYN_GEOMG Asparagine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=asnS PE=3 SV=1 55 517 4.0E-87
sp|Q0HIB6|SYN_SHESM Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=asnS PE=3 SV=1 53 517 4.0E-87
sp|A1S684|SYN_SHEAM Asparagine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=asnS PE=3 SV=1 45 517 6.0E-87
sp|A8GCJ5|SYN_SERP5 Asparagine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=asnS PE=3 SV=1 53 517 8.0E-87
sp|A0KIC3|SYN_AERHH Asparagine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=asnS PE=3 SV=1 57 517 9.0E-87
sp|Q1MQG9|SYN_LAWIP Asparagine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=asnS PE=3 SV=1 53 520 1.0E-86
sp|A1RK52|SYN_SHESW Asparagine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=asnS PE=3 SV=1 53 517 2.0E-86
sp|A4Y6E4|SYN_SHEPC Asparagine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=asnS PE=3 SV=1 53 517 2.0E-86
sp|P47359|SYN_MYCGE Asparagine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=asnS PE=3 SV=1 39 523 2.0E-86
sp|Q9KSF9|SYN_VIBCH Asparagine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=asnS PE=3 SV=2 40 517 3.0E-86
sp|A0KXL6|SYN_SHESA Asparagine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=asnS PE=3 SV=1 53 517 5.0E-86
sp|Q7N622|SYN_PHOLL Asparagine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=asnS PE=3 SV=1 36 517 5.0E-86
sp|Q0HUL3|SYN_SHESR Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=asnS PE=3 SV=1 53 517 6.0E-86
sp|Q6LPQ6|SYN_PHOPR Asparagine--tRNA ligase OS=Photobacterium profundum GN=asnS PE=3 SV=1 40 517 7.0E-86
sp|Q57QZ8|SYN_SALCH Asparagine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=asnS PE=3 SV=1 36 517 1.0E-85
sp|O48593|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYNO PE=2 SV=3 23 517 1.0E-85
sp|A6L0U5|SYN_BACV8 Asparagine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=asnS PE=3 SV=1 53 517 3.0E-85
sp|B2S3J9|SYN_TREPS Asparagine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=asnS PE=3 SV=1 57 517 3.0E-85
sp|O83618|SYN_TREPA Asparagine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=asnS PE=3 SV=1 57 517 3.0E-85
sp|P58696|SYN_SALTY Asparagine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=asnS PE=3 SV=2 36 517 4.0E-85
sp|Q64P24|SYN_BACFR Asparagine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=asnS PE=3 SV=1 53 517 5.0E-85
sp|Q12MT5|SYN_SHEDO Asparagine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=asnS PE=3 SV=1 53 517 5.0E-85
sp|P58694|SYN_ECO57 Asparagine--tRNA ligase OS=Escherichia coli O157:H7 GN=asnS PE=3 SV=2 36 517 6.0E-85
sp|A6T726|SYN_KLEP7 Asparagine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=asnS PE=3 SV=1 36 517 1.0E-84
sp|Q5QZ13|SYN_IDILO Asparagine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|A6VNV7|SYN_ACTSZ Asparagine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=asnS PE=3 SV=1 35 517 2.0E-84
sp|Q3Z3J0|SYN_SHISS Asparagine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|P0A8M2|SYN_SHIFL Asparagine--tRNA ligase OS=Shigella flexneri GN=asnS PE=3 SV=2 36 517 2.0E-84
sp|Q0T6B1|SYN_SHIF8 Asparagine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|Q31YR7|SYN_SHIBS Asparagine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|Q1RDS7|SYN_ECOUT Asparagine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|P0A8M0|SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) GN=asnS PE=1 SV=2 36 517 2.0E-84
sp|B1IW01|SYN_ECOLC Asparagine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|P0A8M1|SYN_ECOL6 Asparagine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=asnS PE=3 SV=2 36 517 2.0E-84
sp|Q0TJC3|SYN_ECOL5 Asparagine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|A7ZYN3|SYN_ECOHS Asparagine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|A7ZK21|SYN_ECO24 Asparagine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=asnS PE=3 SV=1 36 517 2.0E-84
sp|Q56112|SYN_SALTI Asparagine--tRNA ligase OS=Salmonella typhi GN=asnS PE=3 SV=3 36 517 3.0E-84
sp|Q5PGF0|SYN_SALPA Asparagine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=asnS PE=3 SV=1 36 517 3.0E-84
sp|Q5L8W2|SYN_BACFN Asparagine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=asnS PE=3 SV=1 53 517 6.0E-84
sp|Q32E51|SYN_SHIDS Asparagine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=asnS PE=3 SV=1 36 517 7.0E-84
sp|A1JMN8|SYN_YERE8 Asparagine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=asnS PE=3 SV=1 53 517 1.0E-83
sp|A3QE68|SYN_SHELP Asparagine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=asnS PE=3 SV=1 44 517 1.0E-83
sp|Q7MJS0|SYN_VIBVY Asparagine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=asnS PE=3 SV=1 40 517 1.0E-83
sp|Q8DAF0|SYN_VIBVU Asparagine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=asnS PE=3 SV=1 40 517 1.0E-83
sp|A1SW33|SYN_PSYIN Asparagine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=asnS PE=3 SV=1 55 523 1.0E-83
sp|A8H467|SYN_SHEPA Asparagine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=asnS PE=3 SV=1 44 517 2.0E-83
sp|A4W8U9|SYN_ENT38 Asparagine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=asnS PE=3 SV=1 36 517 2.0E-83
sp|Q66CG7|SYN_YERPS Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=asnS PE=3 SV=1 53 517 2.0E-83
sp|A4TMZ6|SYN_YERPP Asparagine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=asnS PE=3 SV=1 53 517 2.0E-83
sp|Q1CGI7|SYN_YERPN Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=asnS PE=3 SV=1 53 517 2.0E-83
sp|P58697|SYN_YERPE Asparagine--tRNA ligase OS=Yersinia pestis GN=asnS PE=3 SV=1 53 517 2.0E-83
sp|Q1CA47|SYN_YERPA Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=asnS PE=3 SV=1 53 517 2.0E-83
sp|A7FJU5|SYN_YERP3 Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=asnS PE=3 SV=1 53 517 2.0E-83
sp|B0TUU1|SYN_SHEHH Asparagine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=asnS PE=3 SV=1 44 517 2.0E-83
sp|B3R0I1|SYN_PHYMT Asparagine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=asnS PE=3 SV=1 40 516 3.0E-83
sp|Q8A0Z8|SYN_BACTN Asparagine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=asnS PE=3 SV=1 53 517 5.0E-83
sp|Q081Q0|SYN_SHEFN Asparagine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=asnS PE=3 SV=1 53 517 6.0E-83
sp|Q4A7W9|SYN_MYCH7 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=asnS PE=3 SV=1 37 517 8.0E-83
sp|Q600N9|SYN_MYCH2 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=asnS PE=3 SV=1 37 517 1.0E-82
sp|Q2NU85|SYN_SODGM Asparagine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=asnS PE=3 SV=1 36 517 1.0E-82
sp|Q4A9S1|SYN_MYCHJ Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=asnS PE=3 SV=1 37 517 1.0E-82
sp|Q9CN06|SYN_PASMU Asparagine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=asnS PE=3 SV=2 54 517 1.0E-82
sp|Q87A82|SYN_XYLFT Asparagine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=asnS PE=3 SV=1 53 523 1.0E-82
sp|Q481G3|SYN_COLP3 Asparagine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=asnS PE=3 SV=1 36 517 2.0E-82
sp|Q5E5P2|SYN_VIBF1 Asparagine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=asnS PE=3 SV=1 40 517 3.0E-82
sp|Q7MVE5|SYN_PORGI Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=asnS PE=3 SV=1 55 517 3.0E-82
sp|B2RK42|SYN_PORG3 Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=asnS PE=3 SV=1 55 517 3.0E-82
sp|Q9PAF5|SYN_XYLFA Asparagine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=asnS PE=3 SV=1 53 517 4.0E-82
sp|B3PNG8|SYN_MYCA5 Asparagine--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=asnS PE=3 SV=1 56 520 7.0E-82
sp|Q0I2M9|SYN_HAES1 Asparagine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=asnS PE=3 SV=1 35 517 2.0E-81
sp|Q7VLL7|SYN_HAEDU Asparagine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=asnS PE=3 SV=1 35 517 3.0E-81
sp|B1V8X4|SYN_PHYAS Asparagine--tRNA ligase OS=Phytoplasma australiense GN=asnS PE=3 SV=1 55 519 4.0E-81
sp|Q65TR1|SYN_MANSM Asparagine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=asnS PE=3 SV=1 54 517 4.0E-81
sp|B0UTU8|SYN_HISS2 Asparagine--tRNA ligase OS=Histophilus somni (strain 2336) GN=asnS PE=3 SV=1 35 517 6.0E-81
sp|B6YRL1|SYN_AZOPC Asparagine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=asnS PE=3 SV=1 54 517 8.0E-81
sp|P57441|SYN_BUCAI Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=asnS PE=3 SV=1 55 517 1.0E-80
sp|B3H198|SYN_ACTP7 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=asnS PE=3 SV=1 35 517 1.0E-80
sp|A3N039|SYN_ACTP2 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=asnS PE=3 SV=1 35 517 1.0E-80
sp|A5UF16|SYN_HAEIG Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=asnS PE=3 SV=1 35 517 1.0E-80
sp|B8F3Y5|SYN_HAEPS Asparagine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=asnS PE=3 SV=1 35 517 2.0E-80
sp|Q1LT63|SYN_BAUCH Asparagine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=asnS PE=3 SV=1 55 518 2.0E-80
sp|B0BNV4|SYN_ACTPJ Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=asnS PE=3 SV=1 35 517 3.0E-80
sp|A5UCB9|SYN_HAEIE Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=asnS PE=3 SV=1 35 517 5.0E-80
sp|Q15UN9|SYN_PSEA6 Asparagine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=asnS PE=3 SV=1 40 523 7.0E-80
sp|P43829|SYN_HAEIN Asparagine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=asnS PE=3 SV=2 35 517 8.0E-80
sp|Q2SR42|SYN_MYCCT Asparagine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=asnS PE=3 SV=1 55 517 2.0E-78
sp|A9NE58|SYN_ACHLI Asparagine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=asnS PE=3 SV=1 55 517 3.0E-78
sp|Q9PQC6|SYN_UREPA Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=asnS PE=3 SV=1 55 523 5.0E-78
sp|B1AJ04|SYN_UREP2 Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=asnS PE=3 SV=1 55 523 5.0E-78
sp|Q6MUF2|SYN_MYCMS Asparagine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=asnS PE=3 SV=1 55 517 1.0E-77
sp|B5ZBH7|SYN_UREU1 Asparagine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=asnS PE=3 SV=1 36 523 1.0E-77
sp|Q6KHD7|SYN_MYCMO Asparagine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=asnS PE=3 SV=1 37 517 2.0E-77
sp|Q6YPH3|SYN_ONYPE Asparagine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=asnS PE=3 SV=1 59 519 4.0E-77
sp|Q492P3|SYN_BLOPB Asparagine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=asnS PE=3 SV=1 36 517 1.0E-76
sp|Q8K9I7|SYN_BUCAP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=asnS PE=3 SV=1 55 517 3.0E-76
sp|Q7VR09|SYN_BLOFL Asparagine--tRNA ligase OS=Blochmannia floridanus GN=asnS PE=3 SV=1 37 517 1.0E-75
sp|Q8D2U1|SYN_WIGBR Asparagine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=asnS PE=3 SV=1 55 517 4.0E-74
sp|Q2NIF5|SYN_AYWBP Asparagine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=asnS PE=3 SV=1 59 519 5.0E-74
sp|Q6F0Y5|SYN_MESFL Asparagine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=asnS PE=3 SV=1 55 517 6.0E-74
sp|Q7NBM9|SYN_MYCGA Asparagine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=asnS PE=3 SV=2 40 523 1.0E-73
sp|Q98PF2|SYN_MYCPU Asparagine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=asnS PE=3 SV=1 49 517 1.0E-72
sp|P59517|SYN_BUCBP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=asnS PE=3 SV=1 37 523 1.0E-72
sp|Q6G9A8|SYN_STAAS Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=asnS PE=3 SV=1 37 517 4.0E-67
sp|Q6GGV5|SYN_STAAR Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=asnS PE=3 SV=1 37 517 6.0E-67
sp|A8Z434|SYN_STAAT Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|A6QH05|SYN_STAAE Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|Q5HFW9|SYN_STAAC Asparagine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|Q2FYH6|SYN_STAA8 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|Q2FGY6|SYN_STAA3 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|Q8NWP3|SYN_STAAW Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|P67572|SYN_STAAN Asparagine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=asnS PE=1 SV=1 37 517 1.0E-66
sp|P67571|SYN_STAAM Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|A5ISY4|SYN_STAA9 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|A6U1S3|SYN_STAA2 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|A7X2E9|SYN_STAA1 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=asnS PE=3 SV=1 37 517 1.0E-66
sp|Q2YY52|SYN_STAAB Asparagine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=asnS PE=3 SV=1 37 517 2.0E-66
sp|A0AK01|SYN_LISW6 Asparagine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=asnS PE=3 SV=1 54 517 2.0E-66
sp|Q8EQE2|SYN_OCEIH Asparagine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=asnS PE=3 SV=1 54 517 3.0E-66
sp|Q71YB9|SYN_LISMF Asparagine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=asnS PE=3 SV=1 54 517 1.0E-65
sp|Q92AB2|SYN_LISIN Asparagine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=asnS PE=3 SV=1 54 517 2.0E-65
sp|P58695|SYN_LISMO Asparagine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=asnS PE=3 SV=1 54 517 7.0E-65
sp|P39772|SYN_BACSU Asparagine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=asnS PE=3 SV=2 54 517 4.0E-63
sp|B9LCU8|SYN_CHLSY Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=asnS PE=3 SV=1 55 522 7.0E-63
sp|A9WA97|SYN_CHLAA Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=asnS PE=3 SV=1 55 522 7.0E-63
sp|Q5WGB1|SYN_BACSK Asparagine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=asnS PE=3 SV=1 54 517 7.0E-63
sp|A4J412|SYN_DESRM Asparagine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=asnS PE=3 SV=1 54 517 1.0E-62
sp|A7Z5Y7|SYN_BACMF Asparagine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=asnS PE=3 SV=1 54 517 3.0E-62
sp|Q65I63|SYN_BACLD Asparagine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=asnS PE=3 SV=1 54 517 7.0E-62
sp|Q4L6F8|SYN_STAHJ Asparagine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=asnS PE=3 SV=1 37 517 9.0E-62
sp|B8GBG7|SYN_CHLAD Asparagine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=asnS PE=3 SV=1 55 522 1.0E-61
sp|Q8CSI9|SYN_STAES Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=asnS PE=3 SV=1 37 517 1.0E-61
sp|Q5HP89|SYN_STAEQ Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=asnS PE=3 SV=1 37 517 1.0E-61
sp|Q38X65|SYN_LACSS Asparagine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=asnS PE=3 SV=1 54 522 2.0E-61
sp|A5D2C2|SYN_PELTS Asparagine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=asnS PE=3 SV=1 54 517 1.0E-60
sp|Q49XR0|SYN_STAS1 Asparagine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=asnS PE=3 SV=1 55 517 7.0E-60
sp|Q831X4|SYN_ENTFA Asparagine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=asnS PE=3 SV=1 54 522 3.0E-59
sp|Q038W1|SYN_LACC3 Asparagine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=asnS PE=3 SV=1 54 521 5.0E-59
sp|Q1IHQ3|SYN_KORVE Asparagine--tRNA ligase OS=Koribacter versatilis (strain Ellin345) GN=asnS PE=3 SV=1 51 517 2.0E-58
sp|A4IQ54|SYN_GEOTN Asparagine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=asnS PE=3 SV=1 54 517 3.0E-58
sp|Q050D9|SYN_LEPBL Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=asnS PE=3 SV=1 37 522 4.0E-58
sp|Q04SB3|SYN_LEPBJ Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=asnS PE=3 SV=1 37 522 4.0E-58
sp|A9GBR2|SYN_SORC5 Asparagine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=asnS PE=3 SV=1 37 521 6.0E-58
sp|B2GA02|SYN_LACRJ Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=asnS PE=3 SV=1 54 523 2.0E-57
sp|A5VMP9|SYN_LACRD Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=asnS PE=3 SV=1 54 523 2.0E-57
sp|Q88WA8|SYN2_LACPL Asparagine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS2 PE=3 SV=1 54 522 4.0E-57
sp|Q72QT4|SYN_LEPIC Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asnS PE=3 SV=1 54 522 5.0E-57
sp|Q9KC78|SYN_BACHD Asparagine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=asnS PE=3 SV=1 54 517 6.0E-57
sp|A9AYM5|SYN_HERA2 Asparagine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=asnS PE=3 SV=1 55 517 7.0E-57
sp|Q8F522|SYN_LEPIN Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=asnS PE=3 SV=1 54 522 8.0E-57
sp|Q1WU36|SYN_LACS1 Asparagine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=asnS PE=3 SV=1 37 517 1.0E-56
sp|Q8CWQ4|SYN_STRR6 Asparagine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=asnS PE=3 SV=1 54 517 6.0E-56
sp|Q04JK7|SYN_STRP2 Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=asnS PE=3 SV=1 54 517 6.0E-56
sp|A3CNM0|SYN_STRSV Asparagine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=asnS PE=3 SV=1 51 517 1.0E-55
sp|Q97PR0|SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=asnS PE=1 SV=1 54 517 3.0E-55
sp|A7NHQ4|SYN_ROSCS Asparagine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=asnS PE=3 SV=1 39 517 3.0E-55
sp|Q67P26|SYN_SYMTH Asparagine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=asnS PE=3 SV=1 54 517 2.0E-54
sp|A5UPW5|SYN_ROSS1 Asparagine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=asnS PE=3 SV=1 39 517 3.0E-54
sp|Q5M067|SYN_STRT1 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=asnS PE=3 SV=1 55 517 1.0E-53
sp|Q04EX6|SYN_OENOB Asparagine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=asnS PE=3 SV=1 54 522 1.0E-53
sp|Q5M4S8|SYN_STRT2 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=asnS PE=3 SV=1 54 517 1.0E-53
sp|Q88Y40|SYN1_LACPL Asparagine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS1 PE=3 SV=1 37 517 1.0E-53
sp|Q03L20|SYN_STRTD Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=asnS PE=3 SV=1 54 517 2.0E-53
sp|P54262|SYN_LACDA Asparagine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=asnS1 PE=3 SV=1 60 517 3.0E-53
sp|Q19722|SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=nrs-1 PE=3 SV=1 55 522 1.0E-52
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 220 523 1.0E-52
sp|A2RMQ1|SYN_LACLM Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=asnS PE=3 SV=1 54 522 2.0E-52
sp|A4W083|SYN_STRS2 Asparagine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=asnS PE=3 SV=1 55 517 2.0E-52
sp|Q9SW96|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=1 SV=1 220 523 3.0E-52
sp|P67574|SYN_STRA5 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=asnS PE=3 SV=1 54 517 3.0E-52
sp|P67573|SYN_STRA3 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=asnS PE=3 SV=1 54 517 3.0E-52
sp|Q3K2E5|SYN_STRA1 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=asnS PE=3 SV=1 54 517 3.0E-52
sp|Q1JMN3|SYN_STRPC Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=asnS PE=3 SV=1 55 517 9.0E-52
sp|Q1JCQ7|SYN_STRPB Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=asnS PE=3 SV=1 55 517 9.0E-52
sp|P0DG29|SYN_STRPQ Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|Q48UH6|SYN_STRPM Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|A2RFM5|SYN_STRPG Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|Q1JHS6|SYN_STRPD Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|P67577|SYN_STRP8 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|P0DG28|SYN_STRP3 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|P67575|SYN_STRP1 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|C4V847|SYNC_NOSCE Probable asparagine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100652 PE=3 SV=1 55 522 1.0E-51
sp|Q5XD20|SYN_STRP6 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=asnS PE=3 SV=1 55 517 1.0E-51
sp|Q02X21|SYN_LACLS Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=asnS PE=3 SV=1 54 522 2.0E-51
sp|O57980|SYN_PYRHO Asparagine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=asnS PE=1 SV=1 49 522 3.0E-51
sp|Q9CEK9|SYN_LACLA Asparagine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=asnS PE=3 SV=1 54 522 3.0E-51
sp|Q8SQK8|SYNC_ENCCU Probable asparagine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_1680 PE=3 SV=2 54 522 4.0E-51
sp|Q979Y4|SYN_THEVO Asparagine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=asnS PE=3 SV=1 43 517 4.0E-51
sp|Q1J7K5|SYN_STRPF Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=asnS PE=3 SV=1 55 517 5.0E-51
sp|A4VTZ1|SYN_STRSY Asparagine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=asnS PE=3 SV=1 54 516 5.0E-51
sp|Q8U4D3|SYN_PYRFU Asparagine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=asnS PE=3 SV=2 49 522 6.0E-51
sp|A8YVJ7|SYN_LACH4 Asparagine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=asnS PE=3 SV=1 60 517 2.0E-50
sp|Q043G9|SYN_LACGA Asparagine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=asnS PE=3 SV=1 54 517 2.0E-50
sp|Q9HKS7|SYN_THEAC Asparagine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=asnS PE=3 SV=1 53 517 3.0E-50
sp|Q74JA9|SYN_LACJO Asparagine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=asnS PE=3 SV=1 55 517 3.0E-50
sp|Q8DTM2|SYN_STRMU Asparagine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=asnS PE=3 SV=1 51 523 4.0E-50
sp|Q9V251|SYN_PYRAB Asparagine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=asnS PE=3 SV=1 49 522 5.0E-50
sp|Q1IZA1|SYN_DEIGD Asparagine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=asnS PE=3 SV=1 37 517 1.0E-49
sp|C1CV26|SYN_DEIDV Asparagine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=asnS PE=3 SV=1 54 517 2.0E-49
sp|Q5JHC1|SYN_THEKO Asparagine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=asnS PE=3 SV=1 49 522 2.0E-49
sp|C5A4R8|SYN_THEGJ Asparagine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=asnS PE=3 SV=1 49 522 2.0E-49
sp|A9CTP8|SYNC_ENTBH Probable asparagine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22533 PE=3 SV=1 47 522 5.0E-49
sp|P54263|SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=asnS PE=1 SV=2 37 522 5.0E-49
sp|Q72KF7|SYN_THET2 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=asnS PE=3 SV=1 37 522 7.0E-48
sp|Q554D9|SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=asnS1 PE=1 SV=1 55 521 9.0E-48
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 55 522 2.0E-46
sp|O58776|SYD_PYRHO Aspartate--tRNA(Asp) ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspS PE=3 SV=1 49 522 3.0E-45
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 53 522 4.0E-45
sp|Q9V036|SYD_PYRAB Aspartate--tRNA(Asp) ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspS PE=3 SV=1 49 522 1.0E-44
sp|Q8U2G6|SYD_PYRFU Aspartate--tRNA(Asp) ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aspS PE=3 SV=1 49 522 1.0E-44
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 55 522 3.0E-44
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 55 522 5.0E-43
sp|Q52428|SYD_THEKO Aspartate--tRNA(Asp) ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspS PE=1 SV=2 49 522 9.0E-43
sp|Q2KJG3|SYNC_BOVIN Asparagine--tRNA ligase, cytoplasmic OS=Bos taurus GN=NARS PE=2 SV=3 55 522 2.0E-41
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 55 522 4.0E-41
sp|Q4R4Z1|SYNC_MACFA Asparagine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=NARS PE=2 SV=1 55 522 1.0E-40
sp|Q8TXG4|SYDND_METKA Aspartate--tRNA(Asp/Asn) ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aspS PE=3 SV=1 49 522 2.0E-40
sp|Q9SW95|SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2 OS=Arabidopsis thaliana GN=SYNC2 PE=1 SV=2 220 523 9.0E-40
sp|Q8ZYM8|SYD_PYRAE Aspartate--tRNA(Asp) ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aspS PE=1 SV=1 55 523 7.0E-39
sp|Q9Y9U7|SYDND_AERPE Aspartate--tRNA(Asp/Asn) ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aspS PE=3 SV=2 40 522 2.0E-38
sp|Q5V1N2|SYDND_HALMA Aspartate--tRNA(Asp/Asn) ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aspS PE=3 SV=1 54 522 2.0E-37
sp|P10723|SYNC_BRUMA Asparagine--tRNA ligase, cytoplasmic OS=Brugia malayi PE=1 SV=1 188 522 2.0E-37
sp|O07683|SYDND_HALSA Aspartate--tRNA(Asp/Asn) ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aspS PE=1 SV=1 51 523 4.0E-37
sp|Q5SIC2|SYDND_THET8 Aspartate--tRNA(Asp/Asn) ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspS2 PE=1 SV=1 47 522 3.0E-36
sp|Q2NHT0|SYDND_METST Aspartate--tRNA(Asp/Asn) ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aspS PE=3 SV=1 55 522 5.0E-36
sp|Q58950|SYDND_METJA Aspartate--tRNA(Asp/Asn) ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aspS PE=3 SV=1 34 522 1.0E-35
sp|Q6KZQ3|SYD_PICTO Aspartate--tRNA(Asp) ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=aspS PE=3 SV=1 50 522 2.0E-35
sp|Q3IT59|SYDND_NATPD Aspartate--tRNA(Asp/Asn) ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=aspS PE=3 SV=1 54 522 2.0E-34
sp|O29342|SYDND_ARCFU Aspartate--tRNA(Asp/Asn) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aspS PE=3 SV=1 49 522 2.0E-34
sp|Q2FRU5|SYDND_METHJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aspS PE=3 SV=1 46 522 5.0E-34
sp|Q9RVH4|SYDND_DEIRA Aspartate--tRNA(Asp/Asn) ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aspS2 PE=1 SV=1 193 522 6.0E-34
sp|O26328|SYDND_METTH Aspartate--tRNA(Asp/Asn) ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aspS PE=1 SV=1 49 522 9.0E-34
sp|A6USZ9|SYDND_META3 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aspS PE=3 SV=1 47 521 2.0E-33
sp|A6UQQ8|SYDND_METVS Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aspS PE=3 SV=1 49 522 4.0E-33
sp|Q976I3|SYDND_SULTO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspS PE=1 SV=1 49 522 5.0E-33
sp|Q18KP5|SYDND_HALWD Aspartate--tRNA(Asp/Asn) ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aspS PE=3 SV=1 55 522 4.0E-32
sp|A9A945|SYDND_METM6 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=aspS PE=3 SV=1 49 522 9.0E-32
sp|Q6LWU0|SYDND_METMP Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=aspS PE=3 SV=1 49 522 1.0E-31
sp|A6VHK5|SYDND_METM7 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aspS PE=3 SV=1 49 522 2.0E-31
sp|O24822|SYDND_HALVO Aspartate--tRNA(Asp/Asn) ligase OS=Haloferax volcanii GN=aspS PE=3 SV=2 54 522 6.0E-31
sp|Q980V3|SYDND_SULSO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspS PE=3 SV=1 47 522 6.0E-31
sp|A4G0V5|SYDND_METM5 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aspS PE=3 SV=1 49 522 8.0E-31
sp|A2SPG1|SYDND_METLZ Aspartate--tRNA(Asp/Asn) ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=aspS PE=3 SV=1 43 522 5.0E-30
sp|Q9HJM1|SYD_THEAC Aspartate--tRNA(Asp) ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aspS PE=3 SV=1 51 522 3.0E-29
sp|A3CXH4|SYDND_METMJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aspS PE=3 SV=1 51 521 7.0E-28
sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 165 522 2.0E-27
sp|Q8TQ68|SYDND_METAC Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aspS PE=3 SV=1 54 521 2.0E-26
sp|Q12XU7|SYDND_METBU Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aspS PE=3 SV=1 54 521 2.0E-26
sp|Q8Q0R2|SYDND_METMA Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aspS PE=1 SV=1 54 521 3.0E-26
sp|Q979P6|SYD_THEVO Aspartate--tRNA(Asp) ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aspS PE=3 SV=1 54 522 1.0E-25
sp|Q8H104|SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana GN=At4g26870 PE=2 SV=1 166 521 3.0E-25
sp|Q466Y5|SYDND_METBF Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aspS PE=3 SV=1 54 522 8.0E-25
sp|Q75JQ1|SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum GN=aspS1 PE=3 SV=1 163 521 1.0E-24
sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 165 517 3.0E-23
sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=1 SV=2 165 521 4.0E-23
sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 165 521 2.0E-22
sp|Q9M084|SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=IBI1 PE=1 SV=1 163 517 4.0E-22
sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2 165 517 4.0E-22
sp|Q7MB41|SYD_PHOLL Aspartate--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aspS PE=3 SV=1 47 517 7.0E-22
sp|B7XHQ4|SYDC_ENTBH Probable aspartate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21705 PE=3 SV=1 163 522 7.0E-22
sp|A1S6P2|SYD_SHEAM Aspartate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aspS PE=3 SV=1 55 517 2.0E-21
sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 123 521 2.0E-21
sp|B0BQ90|SYD_ACTPJ Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aspS PE=3 SV=1 55 517 8.0E-21
sp|A3N1F3|SYD_ACTP2 Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aspS PE=3 SV=1 55 517 8.0E-21
sp|A4WBM3|SYD_ENT38 Aspartate--tRNA ligase OS=Enterobacter sp. (strain 638) GN=aspS PE=3 SV=1 55 517 9.0E-21
sp|Q03577|SYDC_CAEEL Aspartate--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=drs-1 PE=3 SV=1 165 521 1.0E-20
sp|B3GY37|SYD_ACTP7 Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aspS PE=3 SV=1 55 517 1.0E-20
sp|O74407|SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 163 521 3.0E-20
sp|Q0HIZ5|SYD_SHESM Aspartate--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=aspS PE=3 SV=1 55 517 3.0E-20
sp|A4Y6S5|SYD_SHEPC Aspartate--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aspS PE=3 SV=1 55 517 3.0E-20
sp|A1RJQ6|SYD_SHESW Aspartate--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=aspS PE=3 SV=1 55 517 4.0E-20
sp|Q8EEE9|SYD_SHEON Aspartate--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=aspS PE=3 SV=1 55 517 5.0E-20
sp|B7VMI0|SYD_VIBTL Aspartate--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=aspS PE=3 SV=1 46 517 6.0E-20
sp|A3D477|SYD_SHEB5 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aspS PE=3 SV=1 55 517 6.0E-20
sp|Q0A582|SYDND_ALKEH Aspartate--tRNA(Asp/Asn) ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=aspS PE=3 SV=1 54 517 7.0E-20
sp|A7MEB6|SYD_CROS8 Aspartate--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aspS PE=3 SV=1 55 517 8.0E-20
sp|Q15RN2|SYDND_PSEA6 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aspS PE=3 SV=1 54 517 1.0E-19
sp|A6WNQ6|SYD_SHEB8 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS185) GN=aspS PE=3 SV=1 55 517 1.0E-19
sp|B8EA71|SYD_SHEB2 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS223) GN=aspS PE=3 SV=1 55 517 1.0E-19
sp|A9L3I1|SYD_SHEB9 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS195) GN=aspS PE=3 SV=1 55 517 1.0E-19
sp|A0KWL5|SYD_SHESA Aspartate--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=aspS PE=3 SV=1 55 517 1.0E-19
sp|A1JRL1|SYD_YERE8 Aspartate--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aspS PE=3 SV=1 55 517 1.0E-19
sp|B0VRC7|SYDND_ACIBS Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain SDF) GN=aspS PE=3 SV=1 54 517 2.0E-19
sp|Q0HUY7|SYD_SHESR Aspartate--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=aspS PE=3 SV=1 55 517 2.0E-19
sp|A8FUW6|SYD_SHESH Aspartate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=aspS PE=3 SV=1 55 517 2.0E-19
sp|B6EGJ1|SYD_ALISL Aspartate--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=aspS PE=3 SV=1 46 517 2.0E-19
sp|Q6FEH6|SYDND_ACIAD Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aspS PE=3 SV=2 54 517 3.0E-19
sp|P21889|SYD_ECOLI Aspartate--tRNA ligase OS=Escherichia coli (strain K12) GN=aspS PE=1 SV=1 55 517 4.0E-19
sp|A8A166|SYD_ECOHS Aspartate--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=aspS PE=3 SV=1 55 517 4.0E-19
sp|B1XHD4|SYD_ECODH Aspartate--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=aspS PE=3 SV=1 55 517 4.0E-19
sp|C4ZQF0|SYD_ECOBW Aspartate--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aspS PE=3 SV=1 55 517 4.0E-19
sp|B7USP3|SYD_ECO27 Aspartate--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aspS PE=3 SV=1 55 517 5.0E-19
sp|Q3IIN7|SYD_PSEHT Aspartate--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aspS PE=3 SV=1 55 517 5.0E-19
sp|Q1RAR8|SYD_ECOUT Aspartate--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|Q8FGQ9|SYD_ECOL6 Aspartate--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|Q0TGW6|SYD_ECOL5 Aspartate--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|A1AC27|SYD_ECOK1 Aspartate--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|B7MVZ7|SYD_ECO81 Aspartate--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|B7MBS5|SYD_ECO45 Aspartate--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|Q32H95|SYD_SHIDS Aspartate--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aspS PE=3 SV=1 55 517 7.0E-19
sp|A4SPN5|SYD_AERS4 Aspartate--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=aspS PE=3 SV=1 54 517 8.0E-19
sp|B7LPH8|SYD_ESCF3 Aspartate--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|Q3Z2M4|SYD_SHISS Aspartate--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|Q322D4|SYD_SHIBS Aspartate--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B2TXL2|SYD_SHIB3 Aspartate--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B1LD05|SYD_ECOSM Aspartate--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B6IBU5|SYD_ECOSE Aspartate--tRNA ligase OS=Escherichia coli (strain SE11) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B7NBL7|SYD_ECOLU Aspartate--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B1J0M2|SYD_ECOLC Aspartate--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B7M2F7|SYD_ECO8A Aspartate--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B7L7R9|SYD_ECO55 Aspartate--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|A7ZMZ0|SYD_ECO24 Aspartate--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 54 215 1.0E-18
sp|Q8XCI7|SYD_ECO57 Aspartate--tRNA ligase OS=Escherichia coli O157:H7 GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|Q87QV2|SYD_VIBPA Aspartate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|B5YR11|SYD_ECO5E Aspartate--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|B7NS52|SYD_ECO7I Aspartate--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|Q12N06|SYD_SHEDO Aspartate--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B5EJL3|SYDND_ACIF5 Aspartate--tRNA(Asp/Asn) ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aspS PE=3 SV=1 54 517 2.0E-18
sp|B7J3F7|SYDND_ACIF2 Aspartate--tRNA(Asp/Asn) ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aspS PE=3 SV=1 54 517 2.0E-18
sp|Q2NTJ3|SYD_SODGM Aspartate--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=aspS PE=3 SV=1 55 523 3.0E-18
sp|B8F789|SYD_HAEPS Aspartate--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=aspS PE=3 SV=1 55 517 8.0E-18
sp|P57401|SYD_BUCAI Aspartate--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aspS PE=3 SV=1 55 517 8.0E-18
sp|B8D7K8|SYD_BUCAT Aspartate--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=aspS PE=3 SV=1 55 517 9.0E-18
sp|B8D9A6|SYD_BUCA5 Aspartate--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=aspS PE=3 SV=1 55 517 9.0E-18
sp|Q7VNF0|SYD_HAEDU Aspartate--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aspS PE=3 SV=1 55 517 2.0E-16
sp|A5UAG7|SYD_HAEIE Aspartate--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=aspS PE=3 SV=1 54 517 2.0E-16
sp|P59422|SYD_BUCBP Aspartate--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aspS PE=3 SV=1 55 517 3.0E-16
sp|P43817|SYD_HAEIN Aspartate--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aspS PE=3 SV=1 54 517 4.0E-16
sp|A5UGD3|SYD_HAEIG Aspartate--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=aspS PE=3 SV=1 54 517 5.0E-16
sp|Q318C3|SYK_PROM9 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=lysS PE=3 SV=1 27 516 3.0E-15
sp|Q4QNM1|SYD_HAEI8 Aspartate--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=aspS PE=3 SV=1 54 517 3.0E-15
sp|B5ZQW5|SYK_RHILW Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lysS PE=3 SV=1 39 523 3.0E-15
sp|Q1MBK9|SYK_RHIL3 Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lysS PE=3 SV=1 39 523 4.0E-15
sp|C4K4U5|SYD_HAMD5 Aspartate--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aspS PE=3 SV=1 54 517 4.0E-15
sp|A3PFA8|SYK_PROM0 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=lysS PE=3 SV=1 27 516 7.0E-15
sp|B3Q0S4|SYK_RHIE6 Lysine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=lysS PE=3 SV=1 39 523 8.0E-15
sp|A8G7C4|SYK_PROM2 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=lysS PE=3 SV=1 27 516 1.0E-14
sp|P41908|SYNC_SACPA Asparagine--tRNA ligase, cytoplasmic (Fragment) OS=Saccharomyces paradoxus GN=DED81 PE=3 SV=1 431 522 1.0E-14
sp|A2CDX5|SYDND_PROM3 Aspartate--tRNA(Asp/Asn) ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=aspS PE=3 SV=1 53 304 2.0E-14
sp|Q9ZLL9|SYDND_HELPJ Aspartate--tRNA(Asp/Asn) ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aspS PE=3 SV=1 49 517 3.0E-14
sp|Q2K424|SYK_RHIEC Lysine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lysS PE=3 SV=1 39 523 3.0E-14
sp|Q03E09|SYK_PEDPA Lysine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=lysS PE=3 SV=1 38 516 6.0E-14
sp|Q8PVP6|SYK2_METMA Lysine--tRNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lysS2 PE=3 SV=1 173 517 6.0E-14
sp|A0AF28|SYK_LISW6 Lysine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lysS PE=3 SV=1 23 516 8.0E-14
sp|Q8TSN5|SYK2_METAC Lysine--tRNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lysS2 PE=3 SV=1 55 517 8.0E-14
sp|Q7UZP0|SYK_PROMP Lysine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lysS PE=3 SV=1 54 516 1.0E-13
sp|Q8K9C5|SYK_BUCAP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lysS PE=3 SV=1 172 516 2.0E-13
sp|Q8YAB8|SYK_LISMO Lysine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lysS PE=3 SV=1 23 516 3.0E-13
sp|Q607I4|SYDND_METCA Aspartate--tRNA(Asp/Asn) ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aspS PE=3 SV=1 54 335 4.0E-13
sp|A5EIE6|SYDND_BRASB Aspartate--tRNA(Asp/Asn) ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aspS PE=3 SV=1 54 321 4.0E-13
sp|Q7V3X1|SYDND_PROMM Aspartate--tRNA(Asp/Asn) ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=aspS PE=3 SV=1 53 304 4.0E-13
sp|Q7NG18|SYK_GLOVI Lysine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=lysS PE=3 SV=1 55 516 4.0E-13
sp|Q724I4|SYK_LISMF Lysine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lysS PE=3 SV=1 23 516 5.0E-13
sp|Q89MP9|SYDND_BRADU Aspartate--tRNA(Asp/Asn) ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aspS PE=3 SV=1 38 340 8.0E-13
sp|A1AW56|SYDND_RUTMC Aspartate--tRNA(Asp/Asn) ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aspS PE=3 SV=1 416 517 9.0E-13
sp|C3M9G8|SYDND_RHISN Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium sp. (strain NGR234) GN=aspS PE=3 SV=1 53 321 1.0E-12
sp|Q47N50|SYDND_THEFY Aspartate--tRNA(Asp/Asn) ligase OS=Thermobifida fusca (strain YX) GN=aspS PE=3 SV=1 45 314 1.0E-12
sp|Q5LUX6|SYDND_RUEPO Aspartate--tRNA(Asp/Asn) ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aspS PE=3 SV=1 38 296 2.0E-12
sp|A5N1Y8|SYD_CLOK5 Aspartate--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=aspS PE=3 SV=1 427 519 2.0E-12
sp|B9E5P2|SYD_CLOK1 Aspartate--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=aspS PE=3 SV=1 427 519 2.0E-12
sp|A1BGZ4|SYDND_CHLPD Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=aspS PE=3 SV=1 47 287 2.0E-12
sp|Q5QYV2|SYD_IDILO Aspartate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aspS PE=3 SV=1 47 335 2.0E-12
sp|B3EQ26|SYDND_CHLPB Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=aspS PE=3 SV=1 49 287 2.0E-12
sp|B2SXV7|SYK_BURPP Lysine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lysS PE=3 SV=1 167 516 2.0E-12
sp|Q8UG87|SYDND_AGRFC Aspartate--tRNA(Asp/Asn) ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aspS PE=3 SV=1 49 371 2.0E-12
sp|Q3B3A1|SYDND_CHLL7 Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=aspS PE=3 SV=1 47 287 3.0E-12
sp|Q57DZ8|SYDND_BRUAB Aspartate--tRNA(Asp/Asn) ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|Q2YNA7|SYDND_BRUA2 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella abortus (strain 2308) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|B2S501|SYDND_BRUA1 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella abortus (strain S19) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|P67013|SYDND_BRUSU Aspartate--tRNA(Asp/Asn) ligase OS=Brucella suis biovar 1 (strain 1330) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|B0CL77|SYDND_BRUSI Aspartate--tRNA(Asp/Asn) ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|A5VPT5|SYDND_BRUO2 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|P67012|SYDND_BRUME Aspartate--tRNA(Asp/Asn) ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|C0RI89|SYDND_BRUMB Aspartate--tRNA(Asp/Asn) ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|A9MAD3|SYDND_BRUC2 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=aspS PE=3 SV=1 53 327 3.0E-12
sp|Q28MH9|SYDND_JANSC Aspartate--tRNA(Asp/Asn) ligase OS=Jannaschia sp. (strain CCS1) GN=aspS PE=3 SV=1 39 293 3.0E-12
sp|A4YTC4|SYDND_BRASO Aspartate--tRNA(Asp/Asn) ligase OS=Bradyrhizobium sp. (strain ORS278) GN=aspS PE=3 SV=1 54 369 3.0E-12
sp|P37477|SYK_BACSU Lysine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=lysS PE=3 SV=1 23 517 4.0E-12
sp|Q8U7H6|SYK_AGRFC Lysine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lysS PE=3 SV=1 46 523 4.0E-12
sp|Q83BE5|SYDND_COXBU Aspartate--tRNA(Asp/Asn) ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aspS PE=3 SV=1 54 335 4.0E-12
sp|A9KF44|SYDND_COXBN Aspartate--tRNA(Asp/Asn) ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=aspS PE=3 SV=1 54 335 4.0E-12
sp|A9N999|SYDND_COXBR Aspartate--tRNA(Asp/Asn) ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=aspS PE=3 SV=1 54 335 4.0E-12
sp|Q050Q1|SYK_LEPBL Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lysS PE=3 SV=1 177 516 5.0E-12
sp|Q04SM4|SYK_LEPBJ Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lysS PE=3 SV=1 177 516 5.0E-12
sp|B4ETP3|SYD_PROMH Aspartate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=aspS PE=3 SV=1 423 517 5.0E-12
sp|Q4FSF4|SYDND_PSYA2 Aspartate--tRNA(Asp/Asn) ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aspS PE=3 SV=1 54 349 5.0E-12
sp|A4WPF7|SYDND_RHOS5 Aspartate--tRNA(Asp/Asn) ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aspS PE=3 SV=1 38 293 5.0E-12
sp|Q13WZ5|SYK_BURXL Lysine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=lysS PE=3 SV=1 167 516 5.0E-12
sp|Q87Y31|SYDND_PSESM Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aspS PE=3 SV=1 429 524 5.0E-12
sp|B5YJP5|SYDND_THEYD Aspartate--tRNA(Asp/Asn) ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aspS PE=3 SV=1 390 517 6.0E-12
sp|A3CY14|SYK_METMJ Lysine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lysS PE=3 SV=1 55 517 6.0E-12
sp|Q3K7V6|SYDND_PSEPF Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aspS PE=3 SV=1 423 524 6.0E-12
sp|Q4ZWL5|SYDND_PSEU2 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aspS PE=3 SV=1 429 524 6.0E-12
sp|A6QAE8|SYDND_SULNB Aspartate--tRNA(Asp/Asn) ligase OS=Sulfurovum sp. (strain NBC37-1) GN=aspS PE=3 SV=1 429 517 7.0E-12
sp|Q66AU4|SYD_YERPS Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|A4TJK5|SYD_YERPP Aspartate--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|Q1CJH0|SYD_YERPN Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|A9QYX8|SYD_YERPG Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|Q8ZEV0|SYD_YERPE Aspartate--tRNA ligase OS=Yersinia pestis GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|B2K319|SYD_YERPB Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|Q1C820|SYD_YERPA Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|A7FID0|SYD_YERP3 Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|Q48FC1|SYDND_PSE14 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aspS PE=3 SV=1 429 524 7.0E-12
sp|Q92QV4|SYDND_RHIME Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium meliloti (strain 1021) GN=aspS PE=3 SV=1 53 321 7.0E-12
sp|B1JLL5|SYD_YERPY Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aspS PE=3 SV=1 417 517 7.0E-12
sp|Q3JQP3|SYK_BURP1 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=lysS PE=3 SV=1 35 516 7.0E-12
sp|Q4FMP8|SYDND_PELUB Aspartate--tRNA(Asp/Asn) ligase OS=Pelagibacter ubique (strain HTCC1062) GN=aspS PE=3 SV=1 54 298 7.0E-12
sp|C3JYT1|SYDND_PSEFS Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain SBW25) GN=aspS PE=3 SV=1 423 524 7.0E-12
sp|B1VA97|SYK_PHYAS Lysine--tRNA ligase OS=Phytoplasma australiense GN=lysS PE=3 SV=1 17 516 9.0E-12
sp|B5ZX21|SYDND_RHILW Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aspS PE=3 SV=1 53 371 9.0E-12
sp|Q68XM3|SYDND_RICTY Aspartate--tRNA(Asp/Asn) ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=aspS PE=3 SV=1 55 296 1.0E-11
sp|Q16B16|SYDND_ROSDO Aspartate--tRNA(Asp/Asn) ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aspS PE=3 SV=1 39 296 1.0E-11
sp|A6U7M8|SYDND_SINMW Aspartate--tRNA(Asp/Asn) ligase OS=Sinorhizobium medicae (strain WSM419) GN=aspS PE=3 SV=1 53 321 1.0E-11
sp|Q1QBI9|SYDND_PSYCK Aspartate--tRNA(Asp/Asn) ligase OS=Psychrobacter cryohalolentis (strain K5) GN=aspS PE=3 SV=1 54 349 1.0E-11
sp|C3JYT1|SYDND_PSEFS Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain SBW25) GN=aspS PE=3 SV=1 55 327 2.0E-11
sp|A6UDA0|SYK_SINMW Lysine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=lysS PE=3 SV=1 42 523 2.0E-11
sp|Q63SN9|SYK_BURPS Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|A3NX27|SYK_BURP0 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|A1V5L6|SYK_BURMS Lysine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|Q62IZ9|SYK_BURMA Lysine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|A2SAT3|SYK_BURM9 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|A3ML91|SYK_BURM7 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|Q8EPS0|SYD_OCEIH Aspartate--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=aspS PE=3 SV=1 427 524 2.0E-11
sp|A3NB96|SYK_BURP6 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=lysS PE=3 SV=1 35 516 2.0E-11
sp|B0U572|SYK_XYLFM Lysine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=lysS PE=3 SV=1 31 516 2.0E-11
sp|Q0AYS1|SYDND_SYNWW Aspartate--tRNA(Asp/Asn) ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=aspS PE=3 SV=1 54 296 2.0E-11
sp|Q9CII7|SYK_LACLA Lysine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lysS PE=3 SV=1 177 516 2.0E-11
sp|Q8F4P5|SYK_LEPIN Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lysS PE=3 SV=1 23 516 2.0E-11
sp|A9IVI2|SYDND_BART1 Aspartate--tRNA(Asp/Asn) ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=aspS PE=3 SV=1 54 392 2.0E-11
sp|Q47N50|SYDND_THEFY Aspartate--tRNA(Asp/Asn) ligase OS=Thermobifida fusca (strain YX) GN=aspS PE=3 SV=1 426 523 5.0E-11
sp|A2CDX5|SYDND_PROM3 Aspartate--tRNA(Asp/Asn) ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=aspS PE=3 SV=1 427 522 5.0E-10
sp|Q607I4|SYDND_METCA Aspartate--tRNA(Asp/Asn) ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aspS PE=3 SV=1 429 517 5.0E-10
sp|Q3K7V6|SYDND_PSEPF Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aspS PE=3 SV=1 55 327 2.0E-09
sp|Q7V3X1|SYDND_PROMM Aspartate--tRNA(Asp/Asn) ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=aspS PE=3 SV=1 427 522 3.0E-09
sp|Q0AYS1|SYDND_SYNWW Aspartate--tRNA(Asp/Asn) ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=aspS PE=3 SV=1 427 517 3.0E-09
sp|Q5QYV2|SYD_IDILO Aspartate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aspS PE=3 SV=1 423 517 4.0E-09
sp|A1AW56|SYDND_RUTMC Aspartate--tRNA(Asp/Asn) ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aspS PE=3 SV=1 55 312 5.0E-09
sp|Q87Y31|SYDND_PSESM Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aspS PE=3 SV=1 55 335 8.0E-09
sp|Q4ZWL5|SYDND_PSEU2 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aspS PE=3 SV=1 55 335 1.0E-08
sp|Q48FC1|SYDND_PSE14 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aspS PE=3 SV=1 54 335 1.0E-08
sp|Q4FSF4|SYDND_PSYA2 Aspartate--tRNA(Asp/Asn) ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aspS PE=3 SV=1 429 517 2.0E-08
sp|Q1QBI9|SYDND_PSYCK Aspartate--tRNA(Asp/Asn) ligase OS=Psychrobacter cryohalolentis (strain K5) GN=aspS PE=3 SV=1 429 517 2.0E-08
sp|B4ETP3|SYD_PROMH Aspartate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=aspS PE=3 SV=1 55 334 2.0E-07
sp|B5YJP5|SYDND_THEYD Aspartate--tRNA(Asp/Asn) ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aspS PE=3 SV=1 54 314 6.0E-07
sp|Q66AU4|SYD_YERPS Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|A4TJK5|SYD_YERPP Aspartate--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|Q1CJH0|SYD_YERPN Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|A9QYX8|SYD_YERPG Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|Q8ZEV0|SYD_YERPE Aspartate--tRNA ligase OS=Yersinia pestis GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|B2K319|SYD_YERPB Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|Q1C820|SYD_YERPA Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|A7FID0|SYD_YERP3 Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|B1JLL5|SYD_YERPY Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aspS PE=3 SV=1 47 335 1.0E-06
sp|A6QAE8|SYDND_SULNB Aspartate--tRNA(Asp/Asn) ligase OS=Sulfurovum sp. (strain NBC37-1) GN=aspS PE=3 SV=1 54 296 2.0E-06
sp|Q8EPS0|SYD_OCEIH Aspartate--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=aspS PE=3 SV=1 54 309 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0036094 small molecule binding No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043039 tRNA aminoacylation No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7628
MQRSPLTASWRRLPGPSLPCRRYSVRFGCQAQPWSSMQTVADLAASNLEADVANVDVCGWVRSVRKSANVRFVDI
SDGSSMRPIQAVVDKSLAAELRPGAAVRLSGTWCNLHRQSDGAETGKTTTSHELRVQGVDVLGPSNPQTYPIQNK
YQTPESLRTIVHMRWRTPVNSTLLRLRSDAIALVTRFFFDRKFQQTHPPIITSSDCEGAGEAFSLRAGTADDFFR
QPKYLTVSSQLHLEAQAQALGNVWCLSPTFRAEKSDTCRHLSEFYMLEAEMSFVDDMEHIMDLVQQLMADLARGL
ESLNAATELRQNRLDSRNPAETLAFADLVDAQELRRRWRGLAHPSRWPRITYTEAIERLQSVASNFEHPPVWGEA
LQSEHEKWLAEQVGRDEAGDSLLPVFITHFPRIIKAFYMLRSSSHMAAGETADCFDLIVPGLGELAGGSMREHRL
SELQDNMRLHGLRVPASSDNEENPLAWYLDLRRWGCPPHGGFGLGFDRLLSYLSGVPNVRDVVPFPRHHGRCDC*
Coding >OphauB2|7628
ATGCAGCGCTCTCCACTGACGGCTTCATGGCGCCGTCTCCCCGGCCCGTCCTTGCCATGTCGACGCTACTCGGTG
CGCTTTGGATGCCAGGCCCAGCCATGGTCGTCGATGCAGACGGTGGCAGACCTGGCAGCGTCTAATCTCGAGGCC
GATGTGGCCAATGTCGACGTGTGTGGCTGGGTGCGATCTGTCAGGAAGAGCGCCAATGTCCGCTTCGTCGACATT
AGCGATGGCTCGTCGATGCGGCCCATCCAGGCTGTCGTGGACAAGTCTCTGGCTGCAGAACTGCGCCCGGGAGCT
GCCGTGCGTCTATCGGGCACCTGGTGCAATCTCCACAGGCAGTCTGATGGGGCCGAGACGGGCAAGACGACAACG
AGCCATGAGCTGCGTGTCCAAGGCGTCGACGTGCTGGGCCCCTCGAACCCTCAGACGTATCCCATCCAGAACAAG
TACCAGACACCAGAGAGCCTGCGCACCATTGTCCATATGCGCTGGCGCACTCCAGTCAACTCGACGTTGCTTCGT
CTGCGTTCGGATGCCATTGCCCTCGTCACGCGCTTCTTCTTTGACCGCAAGTTCCAGCAGACGCATCCCCCCATC
ATCACGTCGTCGGACTGCGAGGGAGCTGGCGAGGCCTTTAGCCTCAGGGCCGGTACCGCCGACGACTTCTTCCGC
CAGCCCAAGTACCTGACTGTCTCGAGCCAGCTGCACCTCGAGGCTCAGGCGCAGGCCCTGGGCAACGTCTGGTGC
CTATCTCCCACCTTTCGAGCGGAAAAGAGCGATACTTGTCGCCATCTGAGCGAGTTTTACATGCTCGAGGCCGAA
ATGAGCTTTGTTGACGACATGGAGCACATCATGGACCTGGTGCAGCAACTCATGGCCGACCTGGCCCGGGGACTG
GAATCGCTCAACGCCGCAACCGAGCTCCGGCAGAACCGTCTCGACTCGCGCAATCCTGCCGAGACTCTGGCCTTT
GCCGACCTGGTCGATGCGCAAGAGCTACGGCGACGCTGGCGCGGCCTCGCCCACCCATCACGTTGGCCTCGTATC
ACATATACAGAAGCCATAGAGAGGCTGCAGTCGGTCGCCTCCAACTTTGAGCACCCACCCGTCTGGGGAGAGGCC
TTGCAATCCGAACACGAAAAGTGGTTGGCTGAGCAAGTAGGGCGCGACGAAGCAGGCGACTCTCTTTTACCAGTC
TTCATCACTCACTTCCCACGCATCATCAAGGCCTTTTATATGCTGCGCTCCAGCTCCCACATGGCTGCAGGAGAG
ACGGCCGACTGTTTTGACCTCATTGTCCCGGGCCTTGGGGAGCTCGCAGGCGGCTCCATGCGCGAGCACCGGCTC
TCGGAGCTCCAGGACAACATGCGCCTTCACGGGCTTCGCGTCCCAGCCAGTTCGGACAATGAGGAAAACCCATTG
GCTTGGTACCTCGATCTCAGACGCTGGGGCTGTCCCCCTCACGGCGGCTTTGGCCTCGGCTTTGATCGGCTCTTG
AGCTATCTCTCGGGCGTACCCAACGTTCGCGACGTGGTGCCCTTTCCGCGGCATCATGGGCGCTGCGACTGCTAA
Transcript >OphauB2|7628
ATGCAGCGCTCTCCACTGACGGCTTCATGGCGCCGTCTCCCCGGCCCGTCCTTGCCATGTCGACGCTACTCGGTG
CGCTTTGGATGCCAGGCCCAGCCATGGTCGTCGATGCAGACGGTGGCAGACCTGGCAGCGTCTAATCTCGAGGCC
GATGTGGCCAATGTCGACGTGTGTGGCTGGGTGCGATCTGTCAGGAAGAGCGCCAATGTCCGCTTCGTCGACATT
AGCGATGGCTCGTCGATGCGGCCCATCCAGGCTGTCGTGGACAAGTCTCTGGCTGCAGAACTGCGCCCGGGAGCT
GCCGTGCGTCTATCGGGCACCTGGTGCAATCTCCACAGGCAGTCTGATGGGGCCGAGACGGGCAAGACGACAACG
AGCCATGAGCTGCGTGTCCAAGGCGTCGACGTGCTGGGCCCCTCGAACCCTCAGACGTATCCCATCCAGAACAAG
TACCAGACACCAGAGAGCCTGCGCACCATTGTCCATATGCGCTGGCGCACTCCAGTCAACTCGACGTTGCTTCGT
CTGCGTTCGGATGCCATTGCCCTCGTCACGCGCTTCTTCTTTGACCGCAAGTTCCAGCAGACGCATCCCCCCATC
ATCACGTCGTCGGACTGCGAGGGAGCTGGCGAGGCCTTTAGCCTCAGGGCCGGTACCGCCGACGACTTCTTCCGC
CAGCCCAAGTACCTGACTGTCTCGAGCCAGCTGCACCTCGAGGCTCAGGCGCAGGCCCTGGGCAACGTCTGGTGC
CTATCTCCCACCTTTCGAGCGGAAAAGAGCGATACTTGTCGCCATCTGAGCGAGTTTTACATGCTCGAGGCCGAA
ATGAGCTTTGTTGACGACATGGAGCACATCATGGACCTGGTGCAGCAACTCATGGCCGACCTGGCCCGGGGACTG
GAATCGCTCAACGCCGCAACCGAGCTCCGGCAGAACCGTCTCGACTCGCGCAATCCTGCCGAGACTCTGGCCTTT
GCCGACCTGGTCGATGCGCAAGAGCTACGGCGACGCTGGCGCGGCCTCGCCCACCCATCACGTTGGCCTCGTATC
ACATATACAGAAGCCATAGAGAGGCTGCAGTCGGTCGCCTCCAACTTTGAGCACCCACCCGTCTGGGGAGAGGCC
TTGCAATCCGAACACGAAAAGTGGTTGGCTGAGCAAGTAGGGCGCGACGAAGCAGGCGACTCTCTTTTACCAGTC
TTCATCACTCACTTCCCACGCATCATCAAGGCCTTTTATATGCTGCGCTCCAGCTCCCACATGGCTGCAGGAGAG
ACGGCCGACTGTTTTGACCTCATTGTCCCGGGCCTTGGGGAGCTCGCAGGCGGCTCCATGCGCGAGCACCGGCTC
TCGGAGCTCCAGGACAACATGCGCCTTCACGGGCTTCGCGTCCCAGCCAGTTCGGACAATGAGGAAAACCCATTG
GCTTGGTACCTCGATCTCAGACGCTGGGGCTGTCCCCCTCACGGCGGCTTTGGCCTCGGCTTTGATCGGCTCTTG
AGCTATCTCTCGGGCGTACCCAACGTTCGCGACGTGGTGCCCTTTCCGCGGCATCATGGGCGCTGCGACTGCTAA
Gene >OphauB2|7628
ATGCAGCGCTCTCCACTGACGGCTTCATGGCGCCGTCTCCCCGGCCCGTCCTTGCCATGTCGACGCTACTCGGTG
CGCTTTGGATGCCAGGCCCAGCCATGGTCGTCGATGCAGACGGTGGCAGACCTGGCAGCGTCTAATCTCGAGGCC
GATGTGGCCAATGTCGACGTGTGTGGCTGGGTGCGATCTGTCAGGAAGAGCGCCAATGTCCGCTTCGTCGACATT
AGCGATGGCTCGTCGATGCGGCCCATCCAGGCTGTCGTGGACAAGTCTCTGGCTGCAGAGTGCGTTGCCAGCCTC
CCCAGGGCCAATGCCTTGACCCCAATGCCTTGACCCCAATGCTCAATGGTGGACATGGCGATGCTGATGCTTGTC
GTGGGCTTAGACTGCGCCCGGGAGCTGCCGTGCGTCTATCGGGCACCTGGTGCAATCTCCACAGGCAGTCTGATG
GGGCCGAGACGGGCAAGACGACAACGAGCCATGAGCTGCGTGTCCAAGGCGTCGACGTGCTGGGCCCCTCGAACC
CTCAGGTAATGTTCAGGTGAGCCTGGCATCGCCCGCGCATGGCCACCCCGGCTGACGGCCGCCAAGACGTATCCC
ATCCAGAACAAGTACCAGACACCAGAGAGCCTGCGCACCATTGTCCATATGCGCTGGCGCACTCCAGTCAACTCG
ACGTTGCTTCGTCTGCGTTCGGATGCCATTGCCCTCGTCACGCGCTTCTTCTTTGACCGCAAGTTCCAGCAGACG
CATCCCCCCATCATCACGTCGTCGGACTGCGAGGGAGCTGGCGAGGCCTTTAGCCTCAGGGCCGGTACCGCCGAC
GACTTCTTCCGCCAGCCCAAGTACCTGACTGTCTCGAGCCAGCTGCACCTCGAGGCTCAGGCGCAGGCCCTGGGC
AACGTCTGGTGCCTATCTCCCACCTTTCGAGCGGAAAAGAGCGATACTTGTCGCCATCTGAGCGAGTTTTACATG
CTCGAGGCCGAAATGAGCTTTGTTGACGACATGGAGCACATCATGGACCTGGTGCAGCAACTCATGGCCGACCTG
GCCCGGGGACTGGAATCGCTCAACGCCGCAACCGAGCTCCGGCAGAACCGTCTCGACTCGCGCAATCCTGCCGAG
ACTCTGGCCTTTGCCGACCTGGTCGATGCGCAAGAGCTACGGCGACGCTGGCGCGGCCTCGCCCACCCATCACGT
TGGCCTCGTATCACATATACAGAAGCCATAGAGAGGCTGCAGTCGGTCGCCTCCAACTTTGAGCACCCACCCGTC
TGGGGAGAGGCCTTGCAATCCGAACACGAAAAGTGGTTGGCTGAGCAAGTAGGGCGCGACGAAGCAGGCGACTCT
CTTTTACCAGTCTTCATCACTCACTTCCCACGCATCATCAAGGCCTTTTATATGCTGCGCTCCAGCTCCCACATG
GCTGCAGGAGAGACGGCCGACTGTTTTGACCTCATTGTCCCGGGCCTTGGGGAGCTCGCAGGCGGCTCCATGCGC
GAGCACCGGCTCTCGGAGCTCCAGGACAACATGCGCCTTCACGGGCTTCGCGTCCCAGCCAGTTCGGACAATGAG
GAAAACCCATTGGCTTGGTACCTCGATCTCAGACGCTGGGGCTGTCCCCCTCACGGCGGCTTTGGCCTCGGCTTT
GATCGGCTCTTGAGCTATCTCTCGGGCGTACCCAACGTTCGCGACGTGGTGCCCTTTCCGCGGCATCATGGGCGC
TGCGACTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail