Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7627
Gene name
LocationContig_83:70238..71276
Strand-
Gene length (bp)1038
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263) 5.7E-07 100 162

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1701
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1879
Ophiocordyceps australis map64 (Brazil) OphauB2|7627 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00561
Ophiocordyceps camponoti-rufipedis Ophun1|1368
Ophiocordyceps kimflemingae Ophio5|1089
Ophiocordyceps subramaniannii Hirsu2|1493

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7627
MAPSSRTGRVKPSEVAAETKRYLIPMIREHYIRTHAHPPSSTLYINPQNQLCLHRRIPGTRPPIFYFVADDPVST
ALSYAAKDTWTSQANGGPRIHIPFVCAANERRPGGDWETGCAGYEEKLCRRSNLSAILNTPKPGSKLPTHYPIPL
DGVVFSNSVVVGRGPHDRYDRLDTWMDLPVVSVAPIRWPKLRDNGLHYSFRPERDIMMDKMRGALRICLFHNYDR
VVIGDFGLGNICRNPPREMAEMWRDILLFDPDIRGQFVYVLFAFEEASQSTSRLIHDEIVKRERQGSARSMPHDT
PLASSSASARFPTDMSIFQQVFDPLEIERVLTAPDPRYGLNMITS*
Coding >OphauB2|7627
ATGGCTCCGAGCTCCAGGACGGGGCGAGTCAAGCCATCCGAGGTGGCGGCGGAAACCAAGCGCTACCTGATACCC
ATGATAAGAGAGCATTATATCCGAACTCATGCCCATCCCCCCTCTTCAACCCTCTACATCAATCCCCAGAACCAG
CTTTGCCTCCACCGCCGCATCCCCGGCACTCGCCCTCCCATCTTTTACTTTGTCGCCGACGACCCCGTGTCCACG
GCCCTCTCCTACGCCGCCAAGGACACCTGGACCAGCCAGGCCAATGGAGGGCCTCGCATCCACATCCCCTTTGTC
TGCGCCGCTAATGAGCGCCGTCCTGGCGGCGACTGGGAGACGGGCTGCGCCGGCTACGAGGAGAAGCTGTGCCGC
AGGAGCAACCTGTCGGCCATTCTCAACACGCCCAAGCCCGGAAGCAAGCTGCCCACGCACTATCCCATTCCGCTT
GACGGCGTCGTCTTCTCCAACTCGGTCGTGGTTGGTCGTGGCCCCCATGATCGCTACGACCGCCTCGACACCTGG
ATGGACCTGCCCGTCGTCTCTGTTGCTCCCATCCGCTGGCCAAAGCTCCGAGACAACGGCCTGCACTACTCGTTT
AGGCCCGAGCGCGACATCATGATGGACAAGATGCGTGGTGCCCTGCGTATATGCCTCTTCCACAACTACGACCGC
GTCGTCATTGGAGACTTTGGTCTCGGCAACATCTGTCGCAACCCGCCCAGAGAAATGGCTGAGATGTGGCGCGAT
ATACTACTCTTTGATCCAGATATCCGCGGCCAGTTTGTCTACGTCCTCTTTGCTTTTGAAGAAGCCTCCCAGAGC
ACCTCGCGCCTCATTCACGACGAAATTGTCAAGCGCGAGCGTCAAGGCTCCGCGCGGTCCATGCCCCATGATACG
CCCTTGGCCTCGTCTTCAGCATCTGCTCGTTTCCCCACCGACATGAGCATTTTTCAGCAAGTCTTTGACCCCCTA
GAAATCGAACGTGTCCTCACCGCTCCCGATCCGCGCTATGGCTTGAACATGATCACCTCATGA
Transcript >OphauB2|7627
ATGGCTCCGAGCTCCAGGACGGGGCGAGTCAAGCCATCCGAGGTGGCGGCGGAAACCAAGCGCTACCTGATACCC
ATGATAAGAGAGCATTATATCCGAACTCATGCCCATCCCCCCTCTTCAACCCTCTACATCAATCCCCAGAACCAG
CTTTGCCTCCACCGCCGCATCCCCGGCACTCGCCCTCCCATCTTTTACTTTGTCGCCGACGACCCCGTGTCCACG
GCCCTCTCCTACGCCGCCAAGGACACCTGGACCAGCCAGGCCAATGGAGGGCCTCGCATCCACATCCCCTTTGTC
TGCGCCGCTAATGAGCGCCGTCCTGGCGGCGACTGGGAGACGGGCTGCGCCGGCTACGAGGAGAAGCTGTGCCGC
AGGAGCAACCTGTCGGCCATTCTCAACACGCCCAAGCCCGGAAGCAAGCTGCCCACGCACTATCCCATTCCGCTT
GACGGCGTCGTCTTCTCCAACTCGGTCGTGGTTGGTCGTGGCCCCCATGATCGCTACGACCGCCTCGACACCTGG
ATGGACCTGCCCGTCGTCTCTGTTGCTCCCATCCGCTGGCCAAAGCTCCGAGACAACGGCCTGCACTACTCGTTT
AGGCCCGAGCGCGACATCATGATGGACAAGATGCGTGGTGCCCTGCGTATATGCCTCTTCCACAACTACGACCGC
GTCGTCATTGGAGACTTTGGTCTCGGCAACATCTGTCGCAACCCGCCCAGAGAAATGGCTGAGATGTGGCGCGAT
ATACTACTCTTTGATCCAGATATCCGCGGCCAGTTTGTCTACGTCCTCTTTGCTTTTGAAGAAGCCTCCCAGAGC
ACCTCGCGCCTCATTCACGACGAAATTGTCAAGCGCGAGCGTCAAGGCTCCGCGCGGTCCATGCCCCATGATACG
CCCTTGGCCTCGTCTTCAGCATCTGCTCGTTTCCCCACCGACATGAGCATTTTTCAGCAAGTCTTTGACCCCCTA
GAAATCGAACGTGTCCTCACCGCTCCCGATCCGCGCTATGGCTTGAACATGATCACCTCATGA
Gene >OphauB2|7627
ATGGCTCCGAGCTCCAGGACGGGGCGAGTCAAGCCATCCGAGGTGGCGGCGGAAACCAAGCGCTACCTGATACCC
ATGATAAGAGAGCATTATATCCGAACTCATGCCCATCCCCCCTCTTCAACCCTCTACATCAATCCCCAGAACCAG
CTTTGCCTCCACCGCCGCATCCCCGGCACTCGCCCTCCCATCTTTTACTTTGTCGCCGACGACCCCGTGTCCACG
GCCCTCTCCTACGCCGCCAAGGACACCTGGACCAGCCAGGCCAATGGAGGGCCTCGCATCCACATCCCCTTTGTC
TGCGCCGCTAATGAGCGCCGTCCTGGCGGCGACTGGGAGACGGGCTGCGCCGGCTACGAGGAGAAGCTGTGCCGC
AGGAGCAACCTGTCGGCCATTCTCAACACGCCCAAGCCCGGAAGCAAGCTGCCCACGCACTATCCCATTCCGCTT
GACGGCGTCGTCTTCTCCAACTCGGTCGTGGTTGGTCGTGGCCCCCATGATCGCTACGACCGCCTCGACACCTGG
ATGGACCTGCCCGTCGTCTCTGTTGCTCCCATCCGCTGGCCAAAGCTCCGAGACAACGGCCTGCACTACTCGTTT
AGGCCCGAGCGCGACATCATGATGGACAAGATGCGTGGTGCCCTGCGTATATGCCTCTTCCACAACTACGACCGC
GTCGTCATTGGAGACTTTGGTCTCGGCAACATCTGTCGCAACCCGCCCAGAGAAATGGCTGAGATGTGGCGCGAT
ATACTACTCTTTGATCCAGATATCCGCGGCCAGTTTGTCTACGTCCTCTTTGCTTTTGAAGAAGCCTCCCAGAGC
ACCTCGCGCCTCATTCACGACGAAATTGTCAAGCGCGAGCGTCAAGGCTCCGCGCGGTCCATGCCCCATGATACG
CCCTTGGCCTCGTCTTCAGCATCTGCTCGTTTCCCCACCGACATGAGCATTTTTCAGCAAGTCTTTGACCCCCTA
GAAATCGAACGTGTCCTCACCGCTCCCGATCCGCGCTATGGCTTGAACATGATCACCTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail