Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7621
Gene name
LocationContig_83:48741..49707
Strand-
Gene length (bp)966
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 1.2E-11 58 132

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87179|WSC1_SCHPO Cell wall integrity and stress response component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wsc1 PE=1 SV=3 208 302 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 209 231 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7621
MKTPTLVFAALLAASQACGFLHPTIASREEKGTKIVARDNEASQRPSTFPIPDASTSQGCYSSAGNLTRQEKIQN
LSSGSCHNHCKEKKFWVMGLHGADCYCGFVYPPLSKIADDPNCNYPCPAYGLEACGGLEKGGFWSIYNTGTNIQV
ENQEDPSSSSNPGSSSTKSPTSEDGGSESDRPSVIIQTQTTTPTSDADGDKSSGPNVAGIAAGTVVGVIVAAALI
GGAIFFMRRKRNAEIEEEHRRNAAVNAFINGSKPPGSSGSISMTDARLDPVLSNRRMSDGSIADNEDYSRRILRV
TNA*
Coding >OphauB2|7621
ATGAAGACTCCAACGCTGGTATTTGCCGCTCTTCTGGCTGCTTCACAAGCCTGTGGCTTTCTTCACCCCACGATT
GCATCCCGCGAAGAAAAGGGCACCAAGATTGTGGCACGCGATAATGAAGCCTCACAGAGGCCTAGCACTTTTCCC
ATTCCCGATGCGTCCACCTCGCAAGGCTGCTACTCATCGGCTGGCAATTTGACTCGGCAGGAAAAGATACAAAAC
TTGTCTAGCGGCTCCTGCCACAACCACTGCAAAGAGAAAAAATTCTGGGTCATGGGCTTGCATGGCGCAGACTGC
TACTGCGGCTTCGTATATCCGCCACTGAGCAAAATTGCCGACGACCCCAACTGCAACTATCCCTGTCCCGCGTAT
GGGCTCGAAGCCTGCGGTGGGCTTGAGAAGGGTGGCTTCTGGTCTATATACAACACTGGCACCAATATCCAGGTT
GAGAATCAAGAAGACCCATCTTCCTCTTCTAACCCTGGCTCCAGCTCCACCAAATCTCCAACGTCGGAGGATGGA
GGTTCAGAATCAGACAGGCCTTCTGTAATCATTCAGACTCAGACTACTACTCCCACTTCTGATGCGGATGGAGAT
AAGTCGAGCGGGCCCAATGTGGCCGGTATTGCAGCTGGCACCGTTGTTGGTGTCATTGTTGCAGCTGCCCTCATT
GGGGGCGCCATATTTTTCATGAGACGGAAACGAAATGCCGAGATTGAGGAGGAGCATCGTCGAAACGCTGCTGTC
AATGCCTTTATCAACGGCTCCAAGCCGCCGGGCAGCAGCGGAAGCATCTCCATGACTGATGCTCGCCTCGATCCT
GTCCTATCGAATCGCCGAATGAGCGACGGTAGCATTGCAGACAATGAAGACTACTCGCGTAGGATTCTTAGGGTC
ACAAACGCATGA
Transcript >OphauB2|7621
ATGAAGACTCCAACGCTGGTATTTGCCGCTCTTCTGGCTGCTTCACAAGCCTGTGGCTTTCTTCACCCCACGATT
GCATCCCGCGAAGAAAAGGGCACCAAGATTGTGGCACGCGATAATGAAGCCTCACAGAGGCCTAGCACTTTTCCC
ATTCCCGATGCGTCCACCTCGCAAGGCTGCTACTCATCGGCTGGCAATTTGACTCGGCAGGAAAAGATACAAAAC
TTGTCTAGCGGCTCCTGCCACAACCACTGCAAAGAGAAAAAATTCTGGGTCATGGGCTTGCATGGCGCAGACTGC
TACTGCGGCTTCGTATATCCGCCACTGAGCAAAATTGCCGACGACCCCAACTGCAACTATCCCTGTCCCGCGTAT
GGGCTCGAAGCCTGCGGTGGGCTTGAGAAGGGTGGCTTCTGGTCTATATACAACACTGGCACCAATATCCAGGTT
GAGAATCAAGAAGACCCATCTTCCTCTTCTAACCCTGGCTCCAGCTCCACCAAATCTCCAACGTCGGAGGATGGA
GGTTCAGAATCAGACAGGCCTTCTGTAATCATTCAGACTCAGACTACTACTCCCACTTCTGATGCGGATGGAGAT
AAGTCGAGCGGGCCCAATGTGGCCGGTATTGCAGCTGGCACCGTTGTTGGTGTCATTGTTGCAGCTGCCCTCATT
GGGGGCGCCATATTTTTCATGAGACGGAAACGAAATGCCGAGATTGAGGAGGAGCATCGTCGAAACGCTGCTGTC
AATGCCTTTATCAACGGCTCCAAGCCGCCGGGCAGCAGCGGAAGCATCTCCATGACTGATGCTCGCCTCGATCCT
GTCCTATCGAATCGCCGAATGAGCGACGGTAGCATTGCAGACAATGAAGACTACTCGCGTAGGATTCTTAGGGTC
ACAAACGCATGA
Gene >OphauB2|7621
ATGAAGACTCCAACGCTGGTATTTGCCGCTCTTCTGGCTGCTTCACAAGCCTGTGGCTTTCTTCACCCCACGATT
GCATCCCGCGAAGAAAAGGGCACCAAGATTGTGGCACGCGATAATGAAGCCTCACAGAGGCCTAGCACTTTTCCC
ATTCCCGATGCGTCCACCTCGCAAGGCTGCTACTCATCGGCTGGCAATTTGACTCGGCAGGAAAAGATACAAAAC
TTGTCTAGCGGCTCCTGCCACAACCACTGCAAAGAGAAAAAATTCTGGGTCATGGGCTTGCATGGCGCAGACTGC
TACTGCGGCTTCGTATATCCGCCACTGAGCAAAATTGCCGACGACCCCAACTGCAACTATCCCTGTCCCGCGTAT
GGGCTCGAAGCCTGCGGTGGGCTTGAGAAGGGTGGCTTCTGGTCTATATACAACACTGGCACCAATATCCAGGTT
GAGAATCAAGAAGACCCATCTTCCTCTTCTAACCCTGGCTCCAGCTCCACCAAATCTCCAACGTCGGAGGATGGA
GGTTCAGAATCAGACAGGCCTTCTGTAATCATTCAGACTCAGACTACTACTCCCACTTCTGATGCGGATGGAGAT
AAGTCGAGCGGGCCCAATGTGGCCGGTATTGCAGCTGGCACCGTTGTTGGTGTCATTGTTGCAGCTGCCCTCATT
GGGGGCGCCATATTTTTCATGAGACGGAAACGAAATGCCGAGATTGAGGAGGAGCATCGTCGAAACGCTGCTGTC
AATGCCTTTATCAACGGCTCCAAGCCGCCGGGCAGCAGCGGAAGCATCTCCATGACTGATGCTCGCCTCGATCCT
GTCCTATCGAATCGCCGAATGAGCGACGGTAGCATTGCAGACAATGAAGACTACTCGCGTAGGATTCTTAGGGTA
AGCACCATTGTCTCTTGAGTCTTGGAGGCATGATCTGACCTGAACAACCAGGTCACAAACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail