Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7616
Gene name
LocationContig_83:35923..37126
Strand+
Gene length (bp)1203
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 2.1E-50 162 345

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 116 391 5.0E-33
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 67 386 1.0E-32
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 116 390 3.0E-32
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 145 390 9.0E-32
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 161 392 5.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 116 391 5.0E-33
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 67 386 1.0E-32
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 116 390 3.0E-32
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 145 390 9.0E-32
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 161 392 5.0E-20
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 161 392 1.0E-14
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 144 391 4.0E-14
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 135 365 1.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6518
Ophiocordyceps australis map64 (Brazil) OphauB2|7616 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00548
Ophiocordyceps camponoti-rufipedis Ophun1|3378
Ophiocordyceps kimflemingae Ophio5|4815
Ophiocordyceps subramaniannii Hirsu2|2065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7616
MRFVSQSIASAGFVRSARQSYFRFVPLTAPTNLPRRNFFTSNPYLSSDGHVSDKEAPKLDGQLAPPNPQSPKRKP
SRSARANKSLRRVAIIAQQPKRDVEAGPQNVDPQSSTTIGATCIAESFNMTLVLEILSSHGFSIDPDGNGFDSSE
VVHARAVNGGDIFVFPSGTVVTWSLPSDVVTKQLQHAAEEPHLAEQREEENLDFITDNSKLESTMRGDLVVLGTR
KEHAHGDTLDTTLAKIAFSSGLARSTKLAVLESALTSYFESTRHIPSGLSRGGGVSLKRRFILQKTGELLSLRAR
LNHYSELTDSLPDIFWDSRSELGLEGYYDQVGRALDVNVRIRTLNQKMDYAQEIATVLREMSSEQHGTRLEIIII
LLIAVEVIFELRRILMEPSDPEPHS*
Coding >OphauB2|7616
ATGAGATTTGTCTCCCAGAGCATAGCTTCCGCTGGCTTTGTGCGCAGTGCCCGCCAGAGCTATTTCCGATTCGTG
CCTCTTACAGCTCCCACCAATCTGCCCCGGCGAAACTTCTTCACTTCGAATCCCTATCTATCCTCTGACGGCCAT
GTCTCCGACAAGGAGGCGCCCAAGCTTGATGGTCAGCTCGCGCCGCCAAATCCTCAGTCTCCCAAGCGCAAGCCA
TCGCGCTCAGCCAGGGCCAACAAGTCACTGCGCCGCGTTGCCATTATTGCCCAGCAGCCCAAGCGCGACGTTGAG
GCCGGCCCGCAGAATGTCGACCCCCAATCGTCAACCACCATTGGCGCCACCTGCATCGCCGAGTCGTTCAACATG
ACCCTCGTCCTTGAAATCTTGTCGTCGCACGGCTTCTCCATTGATCCCGACGGTAACGGCTTCGACTCTAGCGAG
GTGGTGCACGCAAGAGCCGTCAACGGCGGTGACATCTTTGTATTTCCCTCAGGCACCGTTGTGACATGGTCGCTG
CCCTCCGATGTCGTCACCAAGCAGCTGCAGCACGCCGCCGAGGAGCCACACCTCGCGGAGCAGCGCGAAGAGGAG
AATCTAGACTTCATCACTGACAACTCAAAGCTCGAGAGCACCATGAGGGGCGACTTGGTCGTTCTCGGTACCCGC
AAGGAACACGCCCACGGCGACACCCTCGACACGACGCTTGCCAAGATTGCCTTTTCCTCAGGTCTGGCCCGCAGC
ACAAAGCTGGCCGTGCTCGAGAGCGCTCTGACGTCGTATTTCGAGAGTACCCGTCACATTCCCAGCGGGCTGTCC
CGCGGCGGCGGCGTGTCCCTCAAGCGCCGCTTCATCCTGCAAAAGACTGGCGAACTGCTCAGCCTGCGTGCCCGC
CTCAACCACTACTCTGAATTAACCGACTCGCTGCCCGACATTTTCTGGGATAGCCGCTCTGAGCTGGGTCTTGAG
GGCTACTATGACCAGGTTGGCCGAGCACTCGACGTCAATGTGCGCATCCGCACTCTCAACCAAAAGATGGACTAT
GCTCAAGAGATTGCCACTGTGCTTCGCGAAATGTCGAGCGAGCAACACGGCACCCGTCTCGAAATCATTATTATC
CTCCTCATTGCCGTCGAAGTCATCTTTGAACTGCGCAGAATTCTCATGGAACCAAGCGACCCTGAGCCACACTCT
TAA
Transcript >OphauB2|7616
ATGAGATTTGTCTCCCAGAGCATAGCTTCCGCTGGCTTTGTGCGCAGTGCCCGCCAGAGCTATTTCCGATTCGTG
CCTCTTACAGCTCCCACCAATCTGCCCCGGCGAAACTTCTTCACTTCGAATCCCTATCTATCCTCTGACGGCCAT
GTCTCCGACAAGGAGGCGCCCAAGCTTGATGGTCAGCTCGCGCCGCCAAATCCTCAGTCTCCCAAGCGCAAGCCA
TCGCGCTCAGCCAGGGCCAACAAGTCACTGCGCCGCGTTGCCATTATTGCCCAGCAGCCCAAGCGCGACGTTGAG
GCCGGCCCGCAGAATGTCGACCCCCAATCGTCAACCACCATTGGCGCCACCTGCATCGCCGAGTCGTTCAACATG
ACCCTCGTCCTTGAAATCTTGTCGTCGCACGGCTTCTCCATTGATCCCGACGGTAACGGCTTCGACTCTAGCGAG
GTGGTGCACGCAAGAGCCGTCAACGGCGGTGACATCTTTGTATTTCCCTCAGGCACCGTTGTGACATGGTCGCTG
CCCTCCGATGTCGTCACCAAGCAGCTGCAGCACGCCGCCGAGGAGCCACACCTCGCGGAGCAGCGCGAAGAGGAG
AATCTAGACTTCATCACTGACAACTCAAAGCTCGAGAGCACCATGAGGGGCGACTTGGTCGTTCTCGGTACCCGC
AAGGAACACGCCCACGGCGACACCCTCGACACGACGCTTGCCAAGATTGCCTTTTCCTCAGGTCTGGCCCGCAGC
ACAAAGCTGGCCGTGCTCGAGAGCGCTCTGACGTCGTATTTCGAGAGTACCCGTCACATTCCCAGCGGGCTGTCC
CGCGGCGGCGGCGTGTCCCTCAAGCGCCGCTTCATCCTGCAAAAGACTGGCGAACTGCTCAGCCTGCGTGCCCGC
CTCAACCACTACTCTGAATTAACCGACTCGCTGCCCGACATTTTCTGGGATAGCCGCTCTGAGCTGGGTCTTGAG
GGCTACTATGACCAGGTTGGCCGAGCACTCGACGTCAATGTGCGCATCCGCACTCTCAACCAAAAGATGGACTAT
GCTCAAGAGATTGCCACTGTGCTTCGCGAAATGTCGAGCGAGCAACACGGCACCCGTCTCGAAATCATTATTATC
CTCCTCATTGCCGTCGAAGTCATCTTTGAACTGCGCAGAATTCTCATGGAACCAAGCGACCCTGAGCCACACTCT
TAA
Gene >OphauB2|7616
ATGAGATTTGTCTCCCAGAGCATAGCTTCCGCTGGCTTTGTGCGCAGTGCCCGCCAGAGCTATTTCCGATTCGTG
CCTCTTACAGCTCCCACCAATCTGCCCCGGCGAAACTTCTTCACTTCGAATCCCTATCTATCCTCTGACGGCCAT
GTCTCCGACAAGGAGGCGCCCAAGCTTGATGGTCAGCTCGCGCCGCCAAATCCTCAGTCTCCCAAGCGCAAGCCA
TCGCGCTCAGCCAGGGCCAACAAGTCACTGCGCCGCGTTGCCATTATTGCCCAGCAGCCCAAGCGCGACGTTGAG
GCCGGCCCGCAGAATGTCGACCCCCAATCGTCAACCACCATTGGCGCCACCTGCATCGCCGAGTCGTTCAACATG
ACCCTCGTCCTTGAAATCTTGTCGTCGCACGGCTTCTCCATTGATCCCGACGGTAACGGCTTCGACTCTAGCGAG
GTGGTGCACGCAAGAGCCGTCAACGGCGGTGACATCTTTGTATTTCCCTCAGGCACCGTTGTGACATGGTCGCTG
CCCTCCGATGTCGTCACCAAGCAGCTGCAGCACGCCGCCGAGGAGCCACACCTCGCGGAGCAGCGCGAAGAGGAG
AATCTAGACTTCATCACTGACAACTCAAAGCTCGAGAGCACCATGAGGGGCGACTTGGTCGTTCTCGGTACCCGC
AAGGAACACGCCCACGGCGACACCCTCGACACGACGCTTGCCAAGATTGCCTTTTCCTCAGGTCTGGCCCGCAGC
ACAAAGCTGGCCGTGCTCGAGAGCGCTCTGACGTCGTATTTCGAGAGTACCCGTCACATTCCCAGCGGGCTGTCC
CGCGGCGGCGGCGTGTCCCTCAAGCGCCGCTTCATCCTGCAAAAGACTGGCGAACTGCTCAGCCTGCGTGCCCGC
CTCAACCACTACTCTGAATTAACCGACTCGCTGCCCGACATTTTCTGGGATAGCCGCTCTGAGCTGGGTCTTGAG
GGCTACTATGACCAGGTTGGCCGAGCACTCGACGTCAATGTGCGCATCCGCACTCTCAACCAAAAGATGGACTAT
GCTCAAGAGATTGCCACTGTGCTTCGCGAAATGTCGAGCGAGCAACACGGCACCCGTCTCGAAATCATTATTATC
CTCCTCATTGCCGTCGAAGTCATCTTTGAACTGCGCAGAATTCTCATGGAACCAAGCGACCCTGAGCCACACTCT
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail