Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7613
Gene name
LocationContig_83:31501..32126
Strand+
Gene length (bp)625
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6515
Ophiocordyceps australis map64 (Brazil) OphauB2|7613 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2246
Ophiocordyceps kimflemingae Ophio5|4812
Ophiocordyceps subramaniannii Hirsu2|2210

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7613
MSSSIFISAGRSAATSFDNSSSKAVVSSSASSYTSSSSPSSPLSLSKSKFQHSRRPSLLSSAISKQECTVINIGN
PDGPPRLISYLSSSQGFVWNPEIFLPSYVDCDYEPLENQCEPVHEIVLSDEESSNLLPH*
Coding >OphauB2|7613
ATGTCGTCGTCCATCTTCATCTCGGCCGGTCGGTCAGCCGCAACGTCTTTCGATAACTCATCATCCAAGGCAGTC
GTTAGCTCGTCTGCGAGCTCCTACACGAGCTCTTCGTCACCGTCGTCACCCTTGTCCTTGTCTAAATCAAAGTTT
CAGCACTCGCGGCGGCCCAGCCTCCTAAGCTCGGCTATATCCAAGCAAGAATGTACTGTGATCAACATTGGTAAC
CCCGATGGCCCGCCTCGGCTGATCTCGTACCTTTCCTCAAGTCAGGGTTTTGTTTGGAATCCAGAAATATTCTTG
CCATCTTATGTCGATTGCGACTACGAGCCGCTCGAGAACCAGTGCGAGCCGGTCCATGAAATAGTCCTCAGTGAC
GAAGAGTCGAGTAATTTGTTGCCACATTGA
Transcript >OphauB2|7613
ATGTCGTCGTCCATCTTCATCTCGGCCGGTCGGTCAGCCGCAACGTCTTTCGATAACTCATCATCCAAGGCAGTC
GTTAGCTCGTCTGCGAGCTCCTACACGAGCTCTTCGTCACCGTCGTCACCCTTGTCCTTGTCTAAATCAAAGTTT
CAGCACTCGCGGCGGCCCAGCCTCCTAAGCTCGGCTATATCCAAGCAAGAATGTACTGTGATCAACATTGGTAAC
CCCGATGGCCCGCCTCGGCTGATCTCGTACCTTTCCTCAAGTCAGGGTTTTGTTTGGAATCCAGAAATATTCTTG
CCATCTTATGTCGATTGCGACTACGAGCCGCTCGAGAACCAGTGCGAGCCGGTCCATGAAATAGTCCTCAGTGAC
GAAGAGTCGAGTAATTTGTTGCCACATTGA
Gene >OphauB2|7613
ATGTCGTCGTCCATCTTCATCTCGGCCGGTCGGTCAGCCGCAACGTCTTTCGATAACTCATCATCCAAGGCAGTC
GTTAGCTCGTCTGCGAGCTCCTACACGAGCTCTTCGTCACCGTCGTCACCCTTGTCCTTGTCTAAATCAAAGTTT
CAGCACTCGCGGCGGCCCAGCCTCCTAAGTATGCCACATATCATCGAGATCCAAGCCACATGATTGACATCCCTG
TACCATGAGGGACAGTTGGCTATACCCAAGTACTGACTAACCATGGCGCTCAGGCTCGGCTATATCCAAGCAAGA
ATGTACTGTGATCAACATTGGTAACCCCGATGGCCCGCCTCGGCTGGTGAGTAGCATGGCTTCAGCTCCTCTAGA
CACCAGCATTCTGACGAATCCGTCTTTAGATCTCGTACCTTTCCTCAAGTCAGGGTTTTGTTTGGAATCCAGGTT
TGAATTGCTCTGTGCACACTATAGTACACGTCGTGGACTAATTCTGCTGCCATGTCTAGAAATATTCTTGCCATC
TTATGTCGATTGCGACTACGAGCCGCTCGAGAACCAGTGCGAGCCGGTCCATGAAATAGTCCTCAGTGACGAAGA
GTCGAGTAATTTGTTGCCACATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail