Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7608
Gene name
LocationContig_83:19671..20655
Strand-
Gene length (bp)984
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 3.5E-07 23 75

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|861
Ophiocordyceps australis map64 (Brazil) OphauB2|7608 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00535
Ophiocordyceps camponoti-floridani Ophcf2|00536
Ophiocordyceps camponoti-rufipedis Ophun1|3389
Ophiocordyceps kimflemingae Ophio5|7640
Ophiocordyceps subramaniannii Hirsu2|789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7608
MEESPCADSTSTGQVQETPAERQCVICFQAITQPCFLKPCGHHEFDHHCIGRWLQYEYSASECSRRSLARCPICR
ENIIDIAASPSQVGQGKQITQTMPFGHVPSRRGNHSSNYRRSTWFRSDYAESRRRQRCTRRERASLDFRRTVYSH
SLYSLHMGSNPLSGYREISRQRFQTEMQLQNRARAFLRRDLRAFSWLTTPDTDEDSAWPIDSSPAPPSGAQRPRL
ALEKLVSHIMRLLLVFEIRGSDGHLEDDLATHLGRANAKLFIHELHSFLRSPCHRIEDWDRMVRYDTDAIATPRQ
RISQTVMTAAGQRAPLTSNPGPCTRNR*
Coding >OphauB2|7608
ATGGAAGAGTCTCCATGTGCCGACAGTACCTCTACGGGCCAGGTACAAGAGACGCCGGCTGAGCGACAGTGCGTC
ATTTGCTTCCAAGCCATTACCCAGCCATGCTTCTTGAAGCCCTGCGGCCACCATGAATTCGACCACCACTGCATT
GGCCGCTGGCTGCAGTACGAATACTCGGCATCGGAATGCTCGCGCCGCTCTCTTGCCCGATGCCCCATATGCAGA
GAGAACATCATCGACATTGCTGCAAGTCCAAGCCAAGTTGGACAAGGCAAACAAATCACGCAGACCATGCCATTC
GGCCATGTTCCATCACGGCGTGGAAATCATAGCTCCAACTACCGACGGTCCACGTGGTTCAGGAGCGATTATGCC
GAGTCTCGACGTCGTCAGCGCTGTACCCGCAGAGAGCGCGCCAGTCTAGACTTTCGCCGCACCGTCTATTCTCAC
TCGCTATACTCGCTGCACATGGGCTCGAATCCTCTCTCTGGCTACCGCGAGATTTCAAGACAAAGGTTTCAGACC
GAGATGCAGCTGCAGAATCGGGCGCGGGCATTTCTTCGACGCGATCTGCGCGCCTTTAGCTGGCTGACGACTCCA
GACACGGACGAGGACTCTGCTTGGCCCATTGATTCAAGCCCCGCACCACCCTCTGGCGCACAGCGCCCCAGGCTG
GCCCTGGAAAAGCTAGTGAGCCACATCATGCGGCTGCTGCTAGTCTTCGAAATTCGCGGCAGTGACGGCCATCTA
GAAGACGATCTGGCAACACATCTTGGGCGCGCCAATGCAAAACTATTCATACACGAACTACATTCATTTCTGCGA
AGCCCTTGCCATAGGATAGAAGATTGGGACCGCATGGTGCGATATGACACTGATGCTATTGCGACTCCAAGGCAA
CGAATTAGCCAGACGGTCATGACTGCCGCAGGTCAGAGGGCACCCCTGACAAGCAATCCGGGGCCATGTACTCGG
AATAGATAG
Transcript >OphauB2|7608
ATGGAAGAGTCTCCATGTGCCGACAGTACCTCTACGGGCCAGGTACAAGAGACGCCGGCTGAGCGACAGTGCGTC
ATTTGCTTCCAAGCCATTACCCAGCCATGCTTCTTGAAGCCCTGCGGCCACCATGAATTCGACCACCACTGCATT
GGCCGCTGGCTGCAGTACGAATACTCGGCATCGGAATGCTCGCGCCGCTCTCTTGCCCGATGCCCCATATGCAGA
GAGAACATCATCGACATTGCTGCAAGTCCAAGCCAAGTTGGACAAGGCAAACAAATCACGCAGACCATGCCATTC
GGCCATGTTCCATCACGGCGTGGAAATCATAGCTCCAACTACCGACGGTCCACGTGGTTCAGGAGCGATTATGCC
GAGTCTCGACGTCGTCAGCGCTGTACCCGCAGAGAGCGCGCCAGTCTAGACTTTCGCCGCACCGTCTATTCTCAC
TCGCTATACTCGCTGCACATGGGCTCGAATCCTCTCTCTGGCTACCGCGAGATTTCAAGACAAAGGTTTCAGACC
GAGATGCAGCTGCAGAATCGGGCGCGGGCATTTCTTCGACGCGATCTGCGCGCCTTTAGCTGGCTGACGACTCCA
GACACGGACGAGGACTCTGCTTGGCCCATTGATTCAAGCCCCGCACCACCCTCTGGCGCACAGCGCCCCAGGCTG
GCCCTGGAAAAGCTAGTGAGCCACATCATGCGGCTGCTGCTAGTCTTCGAAATTCGCGGCAGTGACGGCCATCTA
GAAGACGATCTGGCAACACATCTTGGGCGCGCCAATGCAAAACTATTCATACACGAACTACATTCATTTCTGCGA
AGCCCTTGCCATAGGATAGAAGATTGGGACCGCATGGTGCGATATGACACTGATGCTATTGCGACTCCAAGGCAA
CGAATTAGCCAGACGGTCATGACTGCCGCAGGTCAGAGGGCACCCCTGACAAGCAATCCGGGGCCATGTACTCGG
AATAGATAG
Gene >OphauB2|7608
ATGGAAGAGTCTCCATGTGCCGACAGTACCTCTACGGGCCAGGTACAAGAGACGCCGGCTGAGCGACAGTGCGTC
ATTTGCTTCCAAGCCATTACCCAGCCATGCTTCTTGAAGCCCTGCGGCCACCATGAATTCGACCACCACTGCATT
GGCCGCTGGCTGCAGTACGAATACTCGGCATCGGAATGCTCGCGCCGCTCTCTTGCCCGATGCCCCATATGCAGA
GAGAACATCATCGACATTGCTGCAAGTCCAAGCCAAGTTGGACAAGGCAAACAAATCACGCAGACCATGCCATTC
GGCCATGTTCCATCACGGCGTGGAAATCATAGCTCCAACTACCGACGGTCCACGTGGTTCAGGAGCGATTATGCC
GAGTCTCGACGTCGTCAGCGCTGTACCCGCAGAGAGCGCGCCAGTCTAGACTTTCGCCGCACCGTCTATTCTCAC
TCGCTATACTCGCTGCACATGGGCTCGAATCCTCTCTCTGGCTACCGCGAGATTTCAAGACAAAGGTTTCAGACC
GAGATGCAGCTGCAGAATCGGGCGCGGGCATTTCTTCGACGCGATCTGCGCGCCTTTAGCTGGCTGACGACTCCA
GACACGGACGAGGACTCTGCTTGGCCCATTGATTCAAGCCCCGCACCACCCTCTGGCGCACAGCGCCCCAGGCTG
GCCCTGGAAAAGCTAGTGAGCCACATCATGCGGCTGCTGCTAGTCTTCGAAATTCGCGGCAGTGACGGCCATCTA
GAAGACGATCTGGCAACACATCTTGGGCGCGCCAATGCAAAACTATTCATACACGAACTACATTCATTTCTGCGA
AGCCCTTGCCATAGGATAGAAGATTGGGACCGCATGGTGCGATATGACACTGATGCTATTGCGACTCCAAGGCAA
CGAATTAGCCAGACGGTCATGACTGCCGCAGGTCAGAGGGCACCCCTGACAAGCAATCCGGGGCCATGTACTCGG
AATAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail