Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7590
Gene name
LocationContig_82:59656..60228
Strand+
Gene length (bp)572
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14232 DUF4334 Domain of unknown function (DUF4334) 3.3E-24 95 152
PF14231 GXWXG GXWXG protein 1.1E-22 25 86

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7590
MSSPEQTWISFTKQSGTIPPKEAAAVFSALKPIKPEFLTRGHGEWKGGDVNTGHPIGKKLHEMKWAGKTFRSTED
VDPIVAYDQDGQRKANLDWGQARLREIKCEDMATAAMIYDKFPIIDLFRYVSEDMVAGIMDSKEFNKDGTFYFYL
TRLC*
Coding >OphauB2|7590
ATGTCTTCGCCTGAGCAAACCTGGATCAGCTTTACAAAACAGAGCGGCACAATCCCTCCCAAAGAGGCTGCAGCA
GTGTTTTCAGCGCTCAAGCCAATCAAGCCTGAATTCTTGACACGCGGCCATGGCGAGTGGAAAGGCGGCGATGTT
AATACCGGCCACCCAATTGGCAAGAAACTACATGAGATGAAGTGGGCCGGCAAGACGTTTCGTAGTACTGAGGAT
GTCGATCCCATTGTGGCTTACGATCAGGACGGGCAACGCAAGGCAAACCTCGATTGGGGTCAGGCCAGACTACGA
GAAATCAAGTGCGAGGACATGGCGACTGCGGCCATGATATATGACAAGTTTCCCATTATTGACTTGTTCCGCTAC
GTTTCAGAAGACATGGTTGCAGGGATTATGGACTCGAAAGAGTTCAATAAGGACGGTACATTTTACTTTTACCTA
ACGCGCCTCTGTTAG
Transcript >OphauB2|7590
ATGTCTTCGCCTGAGCAAACCTGGATCAGCTTTACAAAACAGAGCGGCACAATCCCTCCCAAAGAGGCTGCAGCA
GTGTTTTCAGCGCTCAAGCCAATCAAGCCTGAATTCTTGACACGCGGCCATGGCGAGTGGAAAGGCGGCGATGTT
AATACCGGCCACCCAATTGGCAAGAAACTACATGAGATGAAGTGGGCCGGCAAGACGTTTCGTAGTACTGAGGAT
GTCGATCCCATTGTGGCTTACGATCAGGACGGGCAACGCAAGGCAAACCTCGATTGGGGTCAGGCCAGACTACGA
GAAATCAAGTGCGAGGACATGGCGACTGCGGCCATGATATATGACAAGTTTCCCATTATTGACTTGTTCCGCTAC
GTTTCAGAAGACATGGTTGCAGGGATTATGGACTCGAAAGAGTTCAATAAGGACGGTACATTTTACTTTTACCTA
ACGCGCCTCTGTTAG
Gene >OphauB2|7590
ATGTCTTCGTATGTCTCGTGGCTCCAATGTTATTAATCATGCTCGTTGACCCTATTTTAGGCCTGAGCAAACCTG
GATCAGCTTTACAAAACAGAGCGGCACAATCCCTCCCAAAGAGGCTGCAGCAGTGTTTTCAGCGCTCAAGCCAAT
CAAGCCTGAATTCTTGACACGCGGCCATGGCGAGTGGAAAGGCGGCGATGTTAATACCGGCCACCCAATTGGCAA
GAAACTACATGAGATGAAGTGGGCCGGCAAGACGTTTCGTAGTACTGAGGATGTCGATCCCATTGTGGCTTACGA
TCAGGACGGGCAACGCAAGGCAAACCTCGATTGGGGTCAGGCCAGAGTATGCTCGCTCTTTGCCCATCTTGCCCA
ACTTCAGGGAGCTGACCAGCAAGTAGCTACGAGAAATCAAGTGCGAGGACATGGCGACTGCGGCCATGATATATG
ACAAGTTTCCCATTATTGACTTGTTCCGCTACGTTTCAGAAGACATGGTTGCAGGGATTATGGACTCGAAAGAGT
TCAATAAGGACGGTACATTTTACTTTTACCTAACGCGCCTCTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail