Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7585
Gene name
LocationContig_82:45462..46755
Strand-
Gene length (bp)1293
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13813 MBOAT_2 Membrane bound O-acyl transferase family 2.4E-14 263 347

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 34 53 19
3 58 80 22
4 170 192 22
5 212 234 22
6 311 333 22
7 346 368 22
8 375 393 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7585
MELANILLILVCPAMLFGGLLFPRLAFSHKLARVVFALVAVSATALVVLTVRTTNVKLALGLGFFGPCMAVRSIM
MFLVHEPWKDFAALRLSRTDSYHNLEIEWQTFPSNSLTARFSWVLNLVLDTRALGWCYSASKGRPCHFHSRLMSQ
RFAADKQWCAIANIHKTILGALFRILLAIITVDCCLVYLVPALQRHYQEQPLDPLDNRQGDWLFTLPNFSSTLSL
SFIFIDAFYCMSRLISAVLFLSGDTNSLIGVMQPSPWGSLTSLYYRGLGGLWGDLWHDYFRLEFSSVAAWATKPL
VGSVHPNIVRVAHLFTVFFLSGIAHTCASYMLPSSYHPVRRTLLFFLLQPIAIVAQKLIAPTLKVLIGSMTVYRI
VQLIMTLMWACLMLDLVFDDLLLGGVWEARFIRVLPL*
Coding >OphauB2|7585
ATGGAACTTGCCAATATTCTTCTCATACTCGTCTGTCCAGCCATGCTATTTGGGGGACTCTTGTTTCCACGCTTG
GCTTTTTCTCACAAACTGGCTCGGGTTGTTTTTGCCTTGGTCGCCGTCTCAGCTACCGCTCTCGTTGTCCTGACG
GTCAGGACAACCAATGTGAAGCTAGCCCTTGGCCTGGGTTTCTTTGGGCCGTGTATGGCGGTGCGCAGCATCATG
ATGTTTTTGGTCCACGAGCCATGGAAAGACTTTGCTGCCCTGAGGCTATCACGCACTGACAGCTACCACAATCTT
GAGATTGAGTGGCAGACTTTTCCCTCGAATTCGCTTACGGCTCGCTTTAGCTGGGTTCTCAACCTTGTTCTCGAC
ACCAGAGCTCTCGGTTGGTGCTATTCTGCATCCAAGGGCCGGCCATGCCACTTTCACTCCCGTCTCATGTCTCAG
AGATTTGCAGCCGACAAACAATGGTGCGCCATTGCCAATATACACAAGACTATACTAGGGGCTCTATTCCGAATC
CTGCTTGCCATCATCACTGTCGACTGTTGCCTCGTCTACCTCGTCCCAGCCTTGCAACGACACTATCAAGAGCAG
CCATTAGATCCACTCGACAACAGGCAAGGAGACTGGCTGTTCACACTGCCAAATTTCTCCTCGACGCTGTCTCTC
AGCTTTATCTTCATCGACGCGTTCTACTGCATGTCCCGGCTGATTTCAGCTGTCCTATTCCTTTCTGGCGACACC
AATAGTCTGATAGGAGTCATGCAGCCAAGCCCCTGGGGAAGCCTGACATCCTTGTATTACCGTGGCTTGGGAGGA
CTCTGGGGCGACTTGTGGCATGATTACTTCCGACTCGAATTCTCTTCAGTGGCAGCCTGGGCAACGAAGCCCTTG
GTGGGTTCGGTGCATCCAAACATTGTCAGGGTGGCACATCTCTTTACAGTCTTCTTCTTGTCAGGCATTGCGCAC
ACTTGCGCTTCATACATGCTGCCGTCTAGTTATCATCCCGTCAGGAGAACGCTGCTCTTCTTCCTCCTCCAGCCT
ATTGCAATCGTTGCACAAAAACTTATTGCTCCGACCTTGAAGGTCTTGATAGGCTCCATGACAGTGTACCGCATT
GTTCAACTAATCATGACTTTGATGTGGGCATGTCTCATGTTGGATTTAGTTTTCGATGACCTCCTCTTGGGAGGC
GTTTGGGAGGCTCGCTTCATTCGCGTCTTGCCGTTATAG
Transcript >OphauB2|7585
ATGGAACTTGCCAATATTCTTCTCATACTCGTCTGTCCAGCCATGCTATTTGGGGGACTCTTGTTTCCACGCTTG
GCTTTTTCTCACAAACTGGCTCGGGTTGTTTTTGCCTTGGTCGCCGTCTCAGCTACCGCTCTCGTTGTCCTGACG
GTCAGGACAACCAATGTGAAGCTAGCCCTTGGCCTGGGTTTCTTTGGGCCGTGTATGGCGGTGCGCAGCATCATG
ATGTTTTTGGTCCACGAGCCATGGAAAGACTTTGCTGCCCTGAGGCTATCACGCACTGACAGCTACCACAATCTT
GAGATTGAGTGGCAGACTTTTCCCTCGAATTCGCTTACGGCTCGCTTTAGCTGGGTTCTCAACCTTGTTCTCGAC
ACCAGAGCTCTCGGTTGGTGCTATTCTGCATCCAAGGGCCGGCCATGCCACTTTCACTCCCGTCTCATGTCTCAG
AGATTTGCAGCCGACAAACAATGGTGCGCCATTGCCAATATACACAAGACTATACTAGGGGCTCTATTCCGAATC
CTGCTTGCCATCATCACTGTCGACTGTTGCCTCGTCTACCTCGTCCCAGCCTTGCAACGACACTATCAAGAGCAG
CCATTAGATCCACTCGACAACAGGCAAGGAGACTGGCTGTTCACACTGCCAAATTTCTCCTCGACGCTGTCTCTC
AGCTTTATCTTCATCGACGCGTTCTACTGCATGTCCCGGCTGATTTCAGCTGTCCTATTCCTTTCTGGCGACACC
AATAGTCTGATAGGAGTCATGCAGCCAAGCCCCTGGGGAAGCCTGACATCCTTGTATTACCGTGGCTTGGGAGGA
CTCTGGGGCGACTTGTGGCATGATTACTTCCGACTCGAATTCTCTTCAGTGGCAGCCTGGGCAACGAAGCCCTTG
GTGGGTTCGGTGCATCCAAACATTGTCAGGGTGGCACATCTCTTTACAGTCTTCTTCTTGTCAGGCATTGCGCAC
ACTTGCGCTTCATACATGCTGCCGTCTAGTTATCATCCCGTCAGGAGAACGCTGCTCTTCTTCCTCCTCCAGCCT
ATTGCAATCGTTGCACAAAAACTTATTGCTCCGACCTTGAAGGTCTTGATAGGCTCCATGACAGTGTACCGCATT
GTTCAACTAATCATGACTTTGATGTGGGCATGTCTCATGTTGGATTTAGTTTTCGATGACCTCCTCTTGGGAGGC
GTTTGGGAGGCTCGCTTCATTCGCGTCTTGCCGTTATAG
Gene >OphauB2|7585
ATGGAACTTGCCAATATTCTTCTCATACTCGTCTGTCCAGCCATGCTATTTGGGGGACTCTTGTTTCCACGCTTG
GCTTTTTCTCACAAACTGGCTCGGGTTGTTTTTGCCTTGGTCGCCGTCTCAGCTACCGCTCTCGTTGTCCTGACG
GTCAGGACAACCAATGTGAAGCTAGCCCTTGGCCTGGGTTTCTTTGGGCCGTGTATGGCGGTGCGCAGCATCATG
ATGTTTTTGGTCCACGAGCCATGGAAAGACTTTGCTGCCCTGAGGCTATCACGCACTGACAGCTACCACAATCTT
GAGATTGAGTGGCAGACTTTTCCCTCGAATTCGCTTACGGCTCGCTTTAGCTGGGTTCTCAACCTTGTTCTCGAC
ACCAGAGCTCTCGGTTGGTGCTATTCTGCATCCAAGGGCCGGCCATGCCACTTTCACTCCCGTCTCATGTCTCAG
AGATTTGCAGCCGACAAACAATGGTGCGCCATTGCCAATATACACAAGACTATACTAGGGGCTCTATTCCGAATC
CTGCTTGCCATCATCACTGTCGACTGTTGCCTCGTCTACCTCGTCCCAGCCTTGCAACGACACTATCAAGAGCAG
CCATTAGATCCACTCGACAACAGGCAAGGAGACTGGCTGTTCACACTGCCAAATTTCTCCTCGACGCTGTCTCTC
AGCTTTATCTTCATCGACGCGTTCTACTGCATGTCCCGGCTGATTTCAGCTGTCCTATTCCTTTCTGGCGACACC
AATAGTCTGATAGGAGTCATGCAGCCAAGCCCCTGGGGAAGCCTGACATCCTTGTATTACCGTGGCTTGGGAGGT
TTGTTTCAAATGTTTCACCATGGGAGCAGTGACTAGTCTAATATCTTGACAGGACTCTGGGGCGACTTGTGGCAT
GATTACTTCCGACTCGAATTCTCTTCAGTGGCAGCCTGGGCAACGAAGCCCTTGGTGGGTTCGGTGCATCCAAAC
ATTGTCAGGGTGGCACATCTCTTTACAGTCTTCTTCTTGTCAGGCATTGCGCACACTTGCGCTTCATACATGCTG
CCGTCTAGTTATCATCCCGTCAGGAGAACGCTGCTCTTCTTCCTCCTCCAGCCTATTGCAATCGTTGCACAAAAA
CTTATTGCTCCGACCTTGAAGGTCTTGATAGGCTCCATGACAGTGTACCGCATTGTTCAACTAATCATGACTTTG
ATGTGGGCATGTCTCATGTTGGATTTAGTTTTCGATGACCTCCTCTTGGGAGGCGTTTGGGAGGCTCGCTTCATT
CGCGTCTTGCCGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail