Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7582
Gene name
LocationContig_82:37126..39277
Strand-
Gene length (bp)2151
Transcript length (bp)2151
Coding sequence length (bp)2151
Protein length (aa) 717

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04006 Mpp10 Mpp10 protein 9.6E-98 48 653

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13910|MPP10_SCHPO U3 small nucleolar ribonucleoprotein protein mpp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpp10 PE=1 SV=1 129 716 9.0E-54
sp|P47083|MPP10_YEAST U3 small nucleolar RNA-associated protein MPP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPP10 PE=1 SV=1 214 708 2.0E-51
sp|O00566|MPP10_HUMAN U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens GN=MPHOSPH10 PE=1 SV=2 403 608 2.0E-28
sp|Q810V0|MPP10_MOUSE U3 small nucleolar ribonucleoprotein protein MPP10 OS=Mus musculus GN=Mphosph10 PE=1 SV=2 403 608 5.0E-28

GO

GO Term Description Terminal node
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex Yes
GO:0005634 nucleus Yes
GO:0034457 Mpp10 complex Yes
GO:0006364 rRNA processing Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0034470 ncRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0110165 cellular anatomical entity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0006396 RNA processing No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0043229 intracellular organelle No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7582
MAATVAAPRETSTLLESLQPENRHVFLQPSSAIPNSSLQLVKEALEGFAAQAGQLAEQLLKERRKRKRTDKQQDE
IELIKLRKVYIEGFETGQVWQQANKIISGVLNVSERVFDELVEKGEIVHGSGETDLQDESDEDLMHVQPEDGQED
EDEDEVEDETEFDGLDDDSQDGEPYGQEKQDKEEEDGDESGQDKENEEDSDEQSEEEVQEFIQDPHGLNDGFFSI
DDFNRETQLLEKLDSKGNATTHEDSDEEDVDWSADPLAPSRKQGKATKSSIDQSSSLSDESDDDDGPTFGDMPLD
APEGESEDEAMLDETGSDPDQEGENANEIYYKDFFAQPRRKRNDNAKTKAKGKQVSFQAEPTQQDMERAMADVRR
DLFDDDSDMQDSDDALSDVSAGDPKSRRSTHERRQAKLRDEIRRLEAASVAKREWTLMGEAAATDRPINSLLEED
LDFEHAGKPVAVITPAVSEDIEQLIKRRILARDFDEVRRRRPDAESAPPRRGLVDVADTKPTRGLADEYEEEHLA
RTDAAHANKDGEKLAREEREVQALWTSVCARLDALSSWHYRPKPAAPSLSVVADVAAVSMEDAQPAVASALTAQS
SRLAPQEVYRAADDKAPEGEVLTRAGAPLARAEMSQQQRTRRRRRAKERARKAGSDNFGAAQHEQQQRGKAATQR
DTVAALKRGGVKVINRRGEVTDVEGNKTGQAKSLTSGSLKL*
Coding >OphauB2|7582
ATGGCGGCAACTGTAGCTGCACCGCGCGAGACGTCAACATTACTCGAGAGCCTACAGCCCGAAAACCGCCATGTG
TTTCTGCAACCAAGCTCAGCCATACCAAATTCATCACTACAGCTGGTAAAGGAGGCTCTCGAAGGCTTTGCGGCA
CAGGCTGGACAACTTGCGGAACAGCTACTCAAGGAAAGGCGTAAACGAAAGCGAACAGACAAGCAGCAAGACGAG
ATTGAACTGATTAAGCTGAGAAAAGTATACATTGAAGGGTTCGAGACGGGCCAGGTATGGCAGCAAGCCAACAAG
ATTATCAGCGGCGTATTGAATGTCTCGGAGCGTGTGTTTGATGAACTGGTTGAGAAGGGGGAGATTGTGCACGGC
TCTGGCGAGACAGATTTGCAAGACGAATCCGACGAGGATTTGATGCATGTGCAGCCTGAGGATGGCCAAGAAGAT
GAAGATGAAGATGAGGTTGAGGATGAAACTGAATTCGACGGCCTGGACGATGATTCTCAAGACGGTGAGCCATAT
GGTCAAGAAAAGCAAGACAAGGAAGAGGAAGACGGTGATGAGAGCGGCCAAGACAAAGAGAACGAAGAAGACAGC
GACGAGCAGAGCGAAGAAGAGGTTCAGGAATTCATCCAGGACCCTCATGGCCTTAATGATGGATTCTTCTCCATT
GACGACTTCAATCGGGAAACGCAGCTCTTGGAAAAGCTGGATAGCAAGGGAAATGCCACGACCCATGAGGACAGC
GACGAAGAAGACGTTGACTGGTCCGCCGATCCATTGGCGCCATCAAGAAAGCAAGGCAAGGCGACAAAAAGCAGT
ATCGACCAATCATCATCTTTGTCCGACGAGTCGGACGACGACGATGGGCCGACGTTTGGCGACATGCCACTGGAC
GCTCCAGAGGGCGAAAGCGAAGACGAGGCCATGCTTGACGAGACGGGCTCCGACCCTGACCAAGAGGGGGAGAAT
GCGAATGAGATTTACTACAAGGACTTTTTTGCTCAGCCTCGGCGCAAGAGAAATGACAATGCCAAGACCAAGGCC
AAAGGCAAACAAGTTTCATTTCAAGCAGAGCCAACACAGCAAGACATGGAGCGCGCCATGGCTGACGTGCGGCGC
GATTTATTCGATGACGACTCTGACATGCAAGACTCTGACGACGCACTGTCAGATGTGTCGGCTGGCGATCCCAAA
TCACGCCGCTCCACTCACGAACGACGTCAAGCAAAGCTCAGAGATGAGATCCGGCGACTAGAGGCTGCATCCGTG
GCCAAGCGCGAATGGACTCTAATGGGAGAGGCGGCGGCTACCGATCGGCCCATCAACTCGTTGCTAGAAGAAGAT
TTGGATTTTGAACACGCTGGCAAGCCCGTTGCTGTAATAACACCGGCCGTGTCGGAAGACATTGAGCAGCTGATC
AAGCGTCGCATCCTCGCCCGCGACTTTGATGAGGTGCGCAGACGCAGACCAGATGCCGAGAGCGCGCCGCCGCGA
AGAGGGCTCGTCGACGTGGCCGACACCAAGCCCACGCGCGGGCTGGCCGACGAGTACGAAGAGGAACACTTGGCT
CGCACCGACGCTGCGCACGCAAACAAGGATGGCGAGAAGCTTGCCCGCGAAGAGCGCGAGGTCCAGGCCCTCTGG
ACGTCGGTGTGCGCGCGCCTCGACGCCCTCAGCAGCTGGCACTACCGGCCCAAGCCTGCGGCGCCAAGCCTGTCC
GTCGTGGCTGATGTCGCGGCCGTCAGCATGGAGGACGCACAGCCCGCCGTTGCCTCGGCCCTGACGGCACAGAGC
AGCCGCCTCGCGCCCCAAGAAGTGTACCGCGCGGCCGACGACAAGGCTCCCGAGGGAGAGGTGCTTACGCGTGCC
GGCGCCCCGCTGGCCAGGGCTGAAATGTCGCAGCAACAACGCACGCGGCGTCGTCGCCGGGCCAAGGAGCGAGCG
CGCAAGGCTGGCAGCGACAACTTTGGAGCAGCGCAGCACGAGCAGCAGCAACGGGGCAAGGCGGCCACGCAGCGC
GACACAGTGGCGGCGCTCAAGAGAGGAGGCGTCAAGGTGATTAATCGCCGGGGCGAGGTTACAGACGTCGAGGGC
AACAAGACGGGGCAGGCCAAGAGCCTCACAAGTGGCAGTCTGAAGCTATAG
Transcript >OphauB2|7582
ATGGCGGCAACTGTAGCTGCACCGCGCGAGACGTCAACATTACTCGAGAGCCTACAGCCCGAAAACCGCCATGTG
TTTCTGCAACCAAGCTCAGCCATACCAAATTCATCACTACAGCTGGTAAAGGAGGCTCTCGAAGGCTTTGCGGCA
CAGGCTGGACAACTTGCGGAACAGCTACTCAAGGAAAGGCGTAAACGAAAGCGAACAGACAAGCAGCAAGACGAG
ATTGAACTGATTAAGCTGAGAAAAGTATACATTGAAGGGTTCGAGACGGGCCAGGTATGGCAGCAAGCCAACAAG
ATTATCAGCGGCGTATTGAATGTCTCGGAGCGTGTGTTTGATGAACTGGTTGAGAAGGGGGAGATTGTGCACGGC
TCTGGCGAGACAGATTTGCAAGACGAATCCGACGAGGATTTGATGCATGTGCAGCCTGAGGATGGCCAAGAAGAT
GAAGATGAAGATGAGGTTGAGGATGAAACTGAATTCGACGGCCTGGACGATGATTCTCAAGACGGTGAGCCATAT
GGTCAAGAAAAGCAAGACAAGGAAGAGGAAGACGGTGATGAGAGCGGCCAAGACAAAGAGAACGAAGAAGACAGC
GACGAGCAGAGCGAAGAAGAGGTTCAGGAATTCATCCAGGACCCTCATGGCCTTAATGATGGATTCTTCTCCATT
GACGACTTCAATCGGGAAACGCAGCTCTTGGAAAAGCTGGATAGCAAGGGAAATGCCACGACCCATGAGGACAGC
GACGAAGAAGACGTTGACTGGTCCGCCGATCCATTGGCGCCATCAAGAAAGCAAGGCAAGGCGACAAAAAGCAGT
ATCGACCAATCATCATCTTTGTCCGACGAGTCGGACGACGACGATGGGCCGACGTTTGGCGACATGCCACTGGAC
GCTCCAGAGGGCGAAAGCGAAGACGAGGCCATGCTTGACGAGACGGGCTCCGACCCTGACCAAGAGGGGGAGAAT
GCGAATGAGATTTACTACAAGGACTTTTTTGCTCAGCCTCGGCGCAAGAGAAATGACAATGCCAAGACCAAGGCC
AAAGGCAAACAAGTTTCATTTCAAGCAGAGCCAACACAGCAAGACATGGAGCGCGCCATGGCTGACGTGCGGCGC
GATTTATTCGATGACGACTCTGACATGCAAGACTCTGACGACGCACTGTCAGATGTGTCGGCTGGCGATCCCAAA
TCACGCCGCTCCACTCACGAACGACGTCAAGCAAAGCTCAGAGATGAGATCCGGCGACTAGAGGCTGCATCCGTG
GCCAAGCGCGAATGGACTCTAATGGGAGAGGCGGCGGCTACCGATCGGCCCATCAACTCGTTGCTAGAAGAAGAT
TTGGATTTTGAACACGCTGGCAAGCCCGTTGCTGTAATAACACCGGCCGTGTCGGAAGACATTGAGCAGCTGATC
AAGCGTCGCATCCTCGCCCGCGACTTTGATGAGGTGCGCAGACGCAGACCAGATGCCGAGAGCGCGCCGCCGCGA
AGAGGGCTCGTCGACGTGGCCGACACCAAGCCCACGCGCGGGCTGGCCGACGAGTACGAAGAGGAACACTTGGCT
CGCACCGACGCTGCGCACGCAAACAAGGATGGCGAGAAGCTTGCCCGCGAAGAGCGCGAGGTCCAGGCCCTCTGG
ACGTCGGTGTGCGCGCGCCTCGACGCCCTCAGCAGCTGGCACTACCGGCCCAAGCCTGCGGCGCCAAGCCTGTCC
GTCGTGGCTGATGTCGCGGCCGTCAGCATGGAGGACGCACAGCCCGCCGTTGCCTCGGCCCTGACGGCACAGAGC
AGCCGCCTCGCGCCCCAAGAAGTGTACCGCGCGGCCGACGACAAGGCTCCCGAGGGAGAGGTGCTTACGCGTGCC
GGCGCCCCGCTGGCCAGGGCTGAAATGTCGCAGCAACAACGCACGCGGCGTCGTCGCCGGGCCAAGGAGCGAGCG
CGCAAGGCTGGCAGCGACAACTTTGGAGCAGCGCAGCACGAGCAGCAGCAACGGGGCAAGGCGGCCACGCAGCGC
GACACAGTGGCGGCGCTCAAGAGAGGAGGCGTCAAGGTGATTAATCGCCGGGGCGAGGTTACAGACGTCGAGGGC
AACAAGACGGGGCAGGCCAAGAGCCTCACAAGTGGCAGTCTGAAGCTATAG
Gene >OphauB2|7582
ATGGCGGCAACTGTAGCTGCACCGCGCGAGACGTCAACATTACTCGAGAGCCTACAGCCCGAAAACCGCCATGTG
TTTCTGCAACCAAGCTCAGCCATACCAAATTCATCACTACAGCTGGTAAAGGAGGCTCTCGAAGGCTTTGCGGCA
CAGGCTGGACAACTTGCGGAACAGCTACTCAAGGAAAGGCGTAAACGAAAGCGAACAGACAAGCAGCAAGACGAG
ATTGAACTGATTAAGCTGAGAAAAGTATACATTGAAGGGTTCGAGACGGGCCAGGTATGGCAGCAAGCCAACAAG
ATTATCAGCGGCGTATTGAATGTCTCGGAGCGTGTGTTTGATGAACTGGTTGAGAAGGGGGAGATTGTGCACGGC
TCTGGCGAGACAGATTTGCAAGACGAATCCGACGAGGATTTGATGCATGTGCAGCCTGAGGATGGCCAAGAAGAT
GAAGATGAAGATGAGGTTGAGGATGAAACTGAATTCGACGGCCTGGACGATGATTCTCAAGACGGTGAGCCATAT
GGTCAAGAAAAGCAAGACAAGGAAGAGGAAGACGGTGATGAGAGCGGCCAAGACAAAGAGAACGAAGAAGACAGC
GACGAGCAGAGCGAAGAAGAGGTTCAGGAATTCATCCAGGACCCTCATGGCCTTAATGATGGATTCTTCTCCATT
GACGACTTCAATCGGGAAACGCAGCTCTTGGAAAAGCTGGATAGCAAGGGAAATGCCACGACCCATGAGGACAGC
GACGAAGAAGACGTTGACTGGTCCGCCGATCCATTGGCGCCATCAAGAAAGCAAGGCAAGGCGACAAAAAGCAGT
ATCGACCAATCATCATCTTTGTCCGACGAGTCGGACGACGACGATGGGCCGACGTTTGGCGACATGCCACTGGAC
GCTCCAGAGGGCGAAAGCGAAGACGAGGCCATGCTTGACGAGACGGGCTCCGACCCTGACCAAGAGGGGGAGAAT
GCGAATGAGATTTACTACAAGGACTTTTTTGCTCAGCCTCGGCGCAAGAGAAATGACAATGCCAAGACCAAGGCC
AAAGGCAAACAAGTTTCATTTCAAGCAGAGCCAACACAGCAAGACATGGAGCGCGCCATGGCTGACGTGCGGCGC
GATTTATTCGATGACGACTCTGACATGCAAGACTCTGACGACGCACTGTCAGATGTGTCGGCTGGCGATCCCAAA
TCACGCCGCTCCACTCACGAACGACGTCAAGCAAAGCTCAGAGATGAGATCCGGCGACTAGAGGCTGCATCCGTG
GCCAAGCGCGAATGGACTCTAATGGGAGAGGCGGCGGCTACCGATCGGCCCATCAACTCGTTGCTAGAAGAAGAT
TTGGATTTTGAACACGCTGGCAAGCCCGTTGCTGTAATAACACCGGCCGTGTCGGAAGACATTGAGCAGCTGATC
AAGCGTCGCATCCTCGCCCGCGACTTTGATGAGGTGCGCAGACGCAGACCAGATGCCGAGAGCGCGCCGCCGCGA
AGAGGGCTCGTCGACGTGGCCGACACCAAGCCCACGCGCGGGCTGGCCGACGAGTACGAAGAGGAACACTTGGCT
CGCACCGACGCTGCGCACGCAAACAAGGATGGCGAGAAGCTTGCCCGCGAAGAGCGCGAGGTCCAGGCCCTCTGG
ACGTCGGTGTGCGCGCGCCTCGACGCCCTCAGCAGCTGGCACTACCGGCCCAAGCCTGCGGCGCCAAGCCTGTCC
GTCGTGGCTGATGTCGCGGCCGTCAGCATGGAGGACGCACAGCCCGCCGTTGCCTCGGCCCTGACGGCACAGAGC
AGCCGCCTCGCGCCCCAAGAAGTGTACCGCGCGGCCGACGACAAGGCTCCCGAGGGAGAGGTGCTTACGCGTGCC
GGCGCCCCGCTGGCCAGGGCTGAAATGTCGCAGCAACAACGCACGCGGCGTCGTCGCCGGGCCAAGGAGCGAGCG
CGCAAGGCTGGCAGCGACAACTTTGGAGCAGCGCAGCACGAGCAGCAGCAACGGGGCAAGGCGGCCACGCAGCGC
GACACAGTGGCGGCGCTCAAGAGAGGAGGCGTCAAGGTGATTAATCGCCGGGGCGAGGTTACAGACGTCGAGGGC
AACAAGACGGGGCAGGCCAAGAGCCTCACAAGTGGCAGTCTGAAGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail