Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7581
Gene name
LocationContig_82:35030..36579
Strand+
Gene length (bp)1549
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10516 SHNi-TPR SHNi-TPR 7.7E-10 235 272

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ4|SIM3_SCHPO NASP-related protein sim3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sim3 PE=1 SV=1 44 429 5.0E-27
sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens GN=NASP PE=1 SV=2 175 428 2.0E-08
sp|P06180|HIBN_XENLA Histone-binding protein N1/N2 OS=Xenopus laevis PE=1 SV=3 180 425 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7581
MAEAPAAETSQPRSASPTLIDNASYTLSAEKMSDEEVKAQRVHLADLCAKGTALYARKDYEGASDILSQASILQS
VVNGETAAENADILFHYGRSLFKLGQSKSDVLGAPAAATADKQSSAAKAEGAPHRAAAVAPTLAEEQTQPGPSDA
KKPLFQFTGDENFDDSDDQDDEDAQGQDDDNDDLATAFVILDLARVCYNKQLAKISAQDESAEEKGKGKAQADSP
ALRHIKERLADTHDCLAEIALENERYPSAIEDGRVSLNYKMELYPADTEIVAEAHYKLSLALEFASVTMAGDDGH
NEKRDAIDQNLRDEAIVEMERAITSFRGRVEYREQELKDAGEDSAEEVHLAMKDMKEVLADMEQRLLDLRKDPID
ASSLLADAAAAPLGSILAGALDPEAVEKATAQAIDVSNLVRKKAKPEDASAKRKVENDDAAGQESTSPNKRTKVE
GE*
Coding >OphauB2|7581
ATGGCTGAAGCCCCCGCTGCAGAAACTTCACAACCGCGCAGCGCCTCTCCAACCTTGATTGACAACGCCTCGTAC
ACCCTGTCAGCCGAGAAAATGTCTGACGAAGAAGTCAAAGCTCAGCGCGTCCATCTGGCAGACTTGTGCGCCAAG
GGCACTGCTCTCTACGCCCGCAAGGACTATGAAGGCGCTTCCGACATTCTTTCTCAGGCAAGCATTCTACAGTCG
GTTGTCAATGGCGAGACGGCGGCCGAGAATGCAGACATTCTTTTCCACTACGGTCGCAGCCTCTTCAAGCTTGGA
CAGAGCAAGAGTGACGTCTTGGGGGCGCCTGCGGCTGCCACGGCTGACAAGCAAAGCAGCGCGGCAAAAGCCGAA
GGCGCCCCGCACAGGGCTGCTGCCGTTGCGCCGACGCTGGCTGAGGAACAGACGCAGCCTGGACCATCGGATGCG
AAAAAACCCCTCTTTCAGTTTACCGGCGATGAAAATTTTGACGACTCGGACGACCAAGATGACGAGGACGCTCAA
GGCCAAGACGACGATAATGACGACTTGGCCACTGCCTTTGTCATTCTTGACCTGGCGCGCGTTTGTTACAATAAA
CAGCTAGCCAAAATCTCTGCCCAAGATGAGTCTGCCGAGGAAAAGGGCAAGGGCAAGGCACAGGCCGACTCGCCC
GCCCTCCGTCACATCAAGGAGCGGCTTGCCGACACGCACGACTGTCTGGCTGAGATTGCTCTCGAGAATGAACGA
TATCCTAGTGCTATTGAAGATGGCCGTGTCTCCCTCAACTACAAGATGGAGCTGTATCCTGCCGACACGGAAATC
GTGGCCGAAGCGCACTATAAACTCTCCCTGGCCCTCGAGTTCGCCTCAGTCACCATGGCCGGCGATGACGGCCAC
AATGAGAAGCGCGATGCCATTGATCAGAACCTCCGCGACGAAGCCATTGTCGAAATGGAACGTGCCATTACCAGC
TTCCGTGGCCGAGTGGAATATCGCGAGCAAGAGCTCAAGGATGCCGGCGAAGACTCGGCTGAAGAGGTCCACCTT
GCCATGAAGGACATGAAGGAAGTTTTGGCCGACATGGAGCAGCGGCTTCTTGATTTGCGCAAAGACCCCATTGAT
GCTTCCTCACTCCTCGCAGACGCGGCTGCTGCTCCCTTGGGAAGCATTCTCGCTGGCGCTCTCGATCCCGAGGCT
GTTGAAAAGGCTACCGCTCAGGCTATAGATGTGTCCAATCTAGTTCGCAAAAAGGCCAAGCCAGAAGACGCCAGT
GCCAAGCGCAAGGTTGAAAATGACGATGCTGCTGGCCAAGAATCCACTTCGCCAAACAAGCGGACAAAGGTTGAA
GGCGAGTAA
Transcript >OphauB2|7581
ATGGCTGAAGCCCCCGCTGCAGAAACTTCACAACCGCGCAGCGCCTCTCCAACCTTGATTGACAACGCCTCGTAC
ACCCTGTCAGCCGAGAAAATGTCTGACGAAGAAGTCAAAGCTCAGCGCGTCCATCTGGCAGACTTGTGCGCCAAG
GGCACTGCTCTCTACGCCCGCAAGGACTATGAAGGCGCTTCCGACATTCTTTCTCAGGCAAGCATTCTACAGTCG
GTTGTCAATGGCGAGACGGCGGCCGAGAATGCAGACATTCTTTTCCACTACGGTCGCAGCCTCTTCAAGCTTGGA
CAGAGCAAGAGTGACGTCTTGGGGGCGCCTGCGGCTGCCACGGCTGACAAGCAAAGCAGCGCGGCAAAAGCCGAA
GGCGCCCCGCACAGGGCTGCTGCCGTTGCGCCGACGCTGGCTGAGGAACAGACGCAGCCTGGACCATCGGATGCG
AAAAAACCCCTCTTTCAGTTTACCGGCGATGAAAATTTTGACGACTCGGACGACCAAGATGACGAGGACGCTCAA
GGCCAAGACGACGATAATGACGACTTGGCCACTGCCTTTGTCATTCTTGACCTGGCGCGCGTTTGTTACAATAAA
CAGCTAGCCAAAATCTCTGCCCAAGATGAGTCTGCCGAGGAAAAGGGCAAGGGCAAGGCACAGGCCGACTCGCCC
GCCCTCCGTCACATCAAGGAGCGGCTTGCCGACACGCACGACTGTCTGGCTGAGATTGCTCTCGAGAATGAACGA
TATCCTAGTGCTATTGAAGATGGCCGTGTCTCCCTCAACTACAAGATGGAGCTGTATCCTGCCGACACGGAAATC
GTGGCCGAAGCGCACTATAAACTCTCCCTGGCCCTCGAGTTCGCCTCAGTCACCATGGCCGGCGATGACGGCCAC
AATGAGAAGCGCGATGCCATTGATCAGAACCTCCGCGACGAAGCCATTGTCGAAATGGAACGTGCCATTACCAGC
TTCCGTGGCCGAGTGGAATATCGCGAGCAAGAGCTCAAGGATGCCGGCGAAGACTCGGCTGAAGAGGTCCACCTT
GCCATGAAGGACATGAAGGAAGTTTTGGCCGACATGGAGCAGCGGCTTCTTGATTTGCGCAAAGACCCCATTGAT
GCTTCCTCACTCCTCGCAGACGCGGCTGCTGCTCCCTTGGGAAGCATTCTCGCTGGCGCTCTCGATCCCGAGGCT
GTTGAAAAGGCTACCGCTCAGGCTATAGATGTGTCCAATCTAGTTCGCAAAAAGGCCAAGCCAGAAGACGCCAGT
GCCAAGCGCAAGGTTGAAAATGACGATGCTGCTGGCCAAGAATCCACTTCGCCAAACAAGCGGACAAAGGTTGAA
GGCGAGTAA
Gene >OphauB2|7581
ATGGCTGAAGCCCCCGCTGCAGAAACTTCACAACCGCGCAGCGCCTCTCCAACCTTGATTGACAACGCCTCGTAC
ACCCTGTCAGCCGAGAAAATGTCTGACGAAGAAGTCAAAGCTCAGCGCGTCCATCTGGCAGACTTGTGCGCCAAG
GGCACTGCTCTCTACGCCCGCAAGGACTATGAAGGCGCTTCCGACATTCTTTCTCAGGCAAGCATTCTACAGTCG
GTTGTCAATGGCGAGACGGCGGCCGAGAATGCAGACATTCTTTTCCACTACGGTCGCAGCCTCTTCAAGCTTGGA
CAGAGCAAGAGTGACGTCTTGGGGGCGCCTGCGGCTGCCACGGCTGACAAGCAAAGCAGCGCGGCAAAAGCCGAA
GGCGCCCCGCACAGGGCTGCTGCCGTTGCGCCGACGCTGGCTGAGGAACAGACGCAGCCTGGACCATCGGATGCG
AAAAAACCCCTCTTTCAGTTTACCGGCGATGAAAATTTTGACGACTCGGACGACCAAGATGACGAGGTATCTTGG
CTCTCGACCGACGCTGCTGCACAAGGATATTGCTAATGTGTCATGCCAGGACGCTCAAGGCCAAGACGACGATAA
TGACGACTTGGCCACTGCCTTTGTCATTCTTGACCTGGCGCGCGTTTGTTACAATAAACAGCTAGCCAAAATCTC
TGCCCAAGATGAGTCTGCCGAGGAAAAGGGCAAGGGCAAGGCACAGGCCGACTCGCCCGCCCTCCGTCACATCAA
GGAGCGGCTTGCCGACACGCACGACTGTCTGGCTGAGATTGCTCTCGAGAATGAACGGTACTGCGTCTCCTCGAT
GCCGCCCTTCTGTGCGTCTGCTTACGCCTCATATTCCACAGATATCCTAGTGCTATTGAAGATGGCCGTGTCTCC
CTCAACTACAAGATGGAGCTGTATCCTGCCGACACGGAAATCGTGGCCGAAGCGCACTATAAACTCTCCCTGGCC
CTCGAGTTCGCCTCAGTCACCATGGCCGGCGATGACGGCCACAATGAGAAGCGCGATGCCATTGATCAGAACCTC
CGCGACGAAGCCATTGTCGAAATGGAACGTGCCATTACCAGCTTCCGTGGCCGAGTGGAATATCGCGAGCAAGAG
CTCAAGGATGCCGGCGAAGACTCGGCTGAAGAGGTCCACCTTGCCATGAAGGACATGAAGGAAGTTTTGGCCGAC
ATGGAGCAGCGGGTAAGCTACCCTCCAAGCCAAATGTTGACGCTGCCTCTTTTCAAAAAGTTGCTGACGAGCTTT
GCGAACACAGCTTCTTGATTTGCGCAAAGACCCCATTGATGCTTCCTCACTCCTCGCAGACGCGGCTGCTGCTCC
CTTGGGAAGCATTCTCGCTGGCGCTCTCGATCCCGAGGCTGTTGAAAAGGCTACCGCTCAGGCTATAGATGTGTC
CAATCTAGTTCGCAAAAAGGCCAAGCCAGAAGACGCCAGTGCCAAGCGCAAGGTTGAAAATGACGATGCTGCTGG
CCAAGAATCCACTTCGCCAAACAAGCGGACAAAGGTTGAAGGCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail